1. GPCR/G Protein
  2. CRFR
  3. Corticotropin-releasing factor (human) (acetate)

Corticotropin-releasing factor (human) (acetate) (Synonyms: Human CRF acetate; Human corticotropin-releasing factor acetate)

Cat. No.: HY-P0086A Purity: 98.51%
Handling Instructions

Corticotropin-releasing factor human acetate (Human CRF acetate) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Corticotropin-releasing factor (human) (acetate) Chemical Structure

Corticotropin-releasing factor (human) (acetate) Chemical Structure

Size Price Stock Quantity
1 mg USD 300 In-stock
Estimated Time of Arrival: December 31
5 mg USD 800 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Corticotropin-releasing factor (human) (acetate):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Corticotropin-releasing factor human acetate (Human CRF acetate) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

In Vitro

CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In rats injected with CRF (1 nmol/side), the time spent in the drug-paired compartment during the test session (314±22 s) is significantly shorter than time spent in that compartment during the preconditioning session (520±18 s)[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4817.50

Formula

C₂₁₀H₃₄₈N₆₀O₆₅S₂

Sequence Shortening

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Protect from light, stored under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (protect from light, stored under nitrogen)

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Corticotropin-releasing factor (human) (acetate)Human CRFHuman corticotropin-releasing factorCRFRCorticotropin-releasing Factor ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Corticotropin-releasing factor (human) (acetate)
Cat. No.:
HY-P0086A
Quantity:
MCE Japan Authorized Agent: