1. MAPK/ERK Pathway
  2. JNK


JNKs (c-Jun N-terminal kinases) belong to the mitogen-activated protein kinase family, and are responsive to stress stimuli, such as cytokines,ultraviolet irradiation, heat shock, and osmotic shock. JNKs play a role in T cell differentiation and the cellular apoptosis pathway. Activation occurs through a dual phosphorylation of threonine (Thr) and tyrosine (Tyr) residues within a Thr-Pro-Tyr motif located in kinase subdomain VIII. Activation is carried out by two MAP kinases, MKK4 and MKK7 and JNK can be inactivated by Ser/Thr and Tyr protein phosphatases. Downstream molecules that are activated by JNK include c-Jun, ATF2, ELK1, SMAD4, p53 and HSF1. JNKs can associate with scaffold proteins JNK interacting proteins as well as their upstream kinases JNKK1 and JNKK2 following their activation. JNK activity regulates several important cellular functions including cell growth, differentiation, survival and apoptosis.

JNK Isoform Specific Products:

  • JNK1

  • JNK2

  • JNK3

  • JNK

JNK Related Products (22):

Cat. No. Product Name Effect Purity
  • HY-12041
    SP600125 Inhibitor 98.82%
    SP600125 is a reversible and ATP-competitive JNK inhibitor with IC50s of 40, 40 and 90 nM for JNK1, JNK2 and JNK3, respectively.
  • HY-13319
    JNK-IN-8 Inhibitor 99.38%
    JNK-IN-8 is a potent JNK inhibitor with IC50s of 4.7 nM, 18.7 nM, and 1 nM for JNK1, JNK2, and JNK3, respectively.
  • HY-N2149
    Tomatidine Inhibitor >98.0%
    Tomatidine acts as an anti-inflammatory agent by blocking NF-κB and JNK signaling.
  • HY-15495
    Tanzisertib Inhibitor 99.98%
    Tanzisertib (CC-930) is a potent JNK1/2/3 inhibitor with IC50s of 61/7/6 nM, respectively.
  • HY-N0431
    Astragaloside IV Inhibitor 99.15%
    Astragaloside IV, an active component isolated from Astragalus membranaceus, suppresses the activation of ERK1/2 and JNK, and downregulates matrix metalloproteases (MMP)-2, (MMP)-9 in MDA-MB-231 breast cancer cells.
  • HY-P0069A
    L-JNKI-1 Inhibitor
    L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK. Sequence: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2;DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2.
  • HY-N0148A
    Rutin hydrate Inhibitor
    Rutin hydrate is a flavonol glycoside, able to cross the blood-brain barrier, and acts by inhibiting JNK and ERK1/2 activation and activating mTOR signalling.
  • HY-P0069
    D-JNKI-1 Inhibitor
    D-JNKI-1 is a highly potent and cell-permeable peptide inhibitor of JNK. Sequence: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2;DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2.
  • HY-11010
    AS601245 Inhibitor 98.32%
    AS601245 is a JNK Inhibitor with IC50s of 150, 220, and 70 nM for three JNK human isoforms (hJNK1, hJNK2, and hJNK3), respectively.
  • HY-15617
    JNK-IN-7 Inhibitor 98.05%
    JNK-IN-7 is a potent JNK inhibitor with IC50 of 1.5, 2 and 0.7 nM for JNK1, JNK2 and JNK3, respectively.
  • HY-10366
    BI-78D3 Inhibitor 99.69%
    BI-78D3 functions as a substrate competitive inhibitor of JNK, inhibit the JNK kinase activity (IC50=280 nM).
  • HY-15737
    DB07268 Inhibitor 99.49%
    DB07268 is a potent and selective JNK1 inhibitor with an IC50 value of 9 nM.
  • HY-12829
    SR-3306 Inhibitor
    SR-3306 is a selective, potent, highly brain penetrant JNK inhibitor.
  • HY-14761
    Bentamapimod Inhibitor 98.66%
    Bentamapimod (AS 602801) is an ATP-competitive JNK inhibitor with IC50 of 80 nM, 90 nM, and 230 nM for JNK1, JNK2, and JNK3, respectively.
  • HY-13022
    CC-401 hydrochloride Inhibitor 99.45%
    CC-401 hydrochloride is a potent inhibitor of all three forms of JNK with Ki of 25 to 50 nM.
  • HY-N0044
    Ginsenoside Re Inhibitor 98.04%
    Ginsenoside Re is an extract from Panax notoginseng. Ginsenoside Re decreases the β-amyloid protein (). Ginsenoside Re plays a role in antiinflammation through inhibition of JNK and NF-κB.
  • HY-N0773
    Isovitexin Inhibitor 98.94%
    Isovitexin is a flavonoid isolated from rice hulls of Oryza sativa, possesses anti-inflammatory and anti-oxidant activities; Isovitexin acts like a JNK1/2 inhibitor and inhibits the activation of NF-κB.
  • HY-N3442
    Juglanin Activator >98.0%
    Juglanin is a JNK activator.
  • HY-15881
    TCS JNK 5a Inhibitor 98.91%
    TCS JNK 5a is a potent JNK3 inhibitor with a pIC50 of 6.7. TCS JNK 5a also inhibits JNK2 with a pIC50 of 6.5.
  • HY-100233
    IQ-1 Inhibitor 98.71%
    IQ-1 is a prospective inhibitor of NF-κB/activating protein 1 (AP-1) activity with an IC50 of 2.3±0.41 μM. IQ-1 has binding affinity (Kd values) in the nanomolar range for all three JNKs with Kds of 100 nM, 240 nM, and 360 nM for JNK3, JNK1, and JNK2, respectively.
Isoform Specific Products

Your Search Returned No Results.

Sorry. There is currently no product that acts on isoform together.

Please try each isoform separately.