1. GPCR/G Protein
  2. CRFR


CRFR (Corticotropin-releasing Factor Receptor), also known as corticotropin-releasing hormone receptor (CRHR), belongs to the G protein-coupled receptor family. There are 3 types of this recetpor, CRF1, CRF2 and CRF3 receptor. CRF1 receptor (CRF1 or CRF) is functionally coupled to adenylate cyclase and it belongs to the secretin-like, family B of GPCRs. CRF1 receptor has several splice variants (CRF1c-CRF1m) including CRF. CRF2 receptor is a 411-amino acid protein with approximately 70% identity to the known CRF1 and it is functionally coupled to adenylate cyclase. The CRF2 receptor has been shown to be expressed as three functional splice variants, the CRF (411-413 amino acids), the CRF (431-438 amino acids) and the CRF (397 amino acids). CRF3 receptor is a 428-amino acid protein, which binds CRF with a 5-fold higher affinity than URO and SVG and is expressed in the pituitary gland, urophysis, and brain.

CRFR subserves central functions related to stress physiology, and also exerts peripheral actions relevant to cardiovascular, muscular, gastrointestinal, pancreatic, inflammatory, and neoplastic diseases.

CRFR Related Products (11):

Cat. No. Product Name Effect Purity
  • HY-14127
    R121919 Antagonist 99.46%
    R121919 is a potent small-molecule CRF1 receptor antagonist with a Ki of 2 to 5 nM for the CRF1 receptor and over 1000-fold weaker activity at the CRF2 receptor, CRF-binding protein, or 70 other receptor types.
  • HY-14130
    CP 376395 Antagonist 99.53%
    CP 376395 is a potent and selective Corticotropin releasing factor 1 (CRF1) receptor antagonist.
  • HY-14875
    Verucerfont Antagonist 99.94%
    Verucerfont is a corticotropin-releasing factor receptor 1 (CRF1) antagonist with IC50s of ~6.1, >1000 and >1000 nM for CRF1, CRF2, and CRF-BP, respectively.
  • HY-12127
    Pexacerfont Antagonist
    Pexacerfont is a selective corticotropin-releasing factor (CRF1) receptor antagonist with IC50 of 6.1±0.6 nM for human CRF1 receptor.
  • HY-P1533
    CRF,bovine Agonist
    CRF,bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM. Sequence: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2.
  • HY-P1542
    Urotensin I Agonist
    Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF and mCRF receptors, respectively. Sequence: Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2;NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2.
  • HY-P1296
    Urocortin, rat Agonist
    Urocortin, rat is a selective agonist of CRF receptor, with Kis of 0.32, 2.2, and 0.62 nM for hCRF1, rCRF and mCRF, respectively. Sequence: Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2;DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2.
  • HY-P1295
    Urocortin, human Agonist
    Urocortin, human, a 40-aa neuropeptide, acts as a selective agonist of endogenous CRF2 receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF and mCRF, respectively. Sequence: Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2;DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2.
  • HY-14367
    Emicerfont Antagonist
    Emicerfont is a corticotropin-releasing factor type 1 (CRF1) receptor antagonist with an IC50 of 66 nM.
  • HY-14129
    CP 316311 Antagonist
    CP 316311 is a potent and selective CRF1 receptor antagonist with an IC50 value of 6.8 nM.
  • HY-12339
    NVS-CRF38 Antagonist
    NVS-CRF38 is a novel corticotropin-releasing factor receptor 1 (CRF1) antagonist with low water solubility.
Isoform Specific Products

Your Search Returned No Results.

Sorry. There is currently no product that acts on isoform together.

Please try each isoform separately.