Urocortin III, mouse TFA
Based on 1 Customer Validation
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.
For research use only. We do not sell to patients.
- Purity: 98.06%
- Formula: C186H312N52O52S2.xC2HF3O2
- Molecular Weight:4172.97 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 4172.97 (free base)
-
Formula C186H312N52O52S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
-
Sequence Shortening
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H2O : 25 mg/mL (Need ultrasonic)
Purity & Documentation
References
[1]. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. [Content Brief]
[2]. Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Urocortin III, mouse TFA Related Classifications
HY-P1858A Related Classifications
Powered by Bioz