1. Metabolic Disease

Metabolic Disease

Metabolic diseases is defined by a constellation of interconnected physiological, biochemical, clinical, and metabolic factors that directly increases the risk of cardiovascular disease, type 2 diabetes mellitus, and all cause mortality. Associated conditions include hyperuricemia, fatty liver (especially in concurrent obesity) progressing to nonalcoholic fatty liver disease, polycystic ovarian syndrome (in women), erectile dysfunction (in men), and acanthosis nigricans. Metabolic disease modeling is an essential component of biomedical research and a mandatory prerequisite for the treatment of human disease. Somatic genome editing using CRISPR/Cas9 might be used to establish novel metabolic disease models.

Metabolic Disease Related Products (901):

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-A0190
    Ceruletide 17650-98-5 99.96%
    Ceruletide, a biologically active decapeptide isolated from the skin of the Australian frog Hyla caerulea, is a potent cholecystokinetic agent, and acts as a cholecystokinin receptor agonist. Sequence: {pGlu}-Gln-Asp-Tyr(SO3H)-Thr-Gly-Trp-Met-Asp-Phe-NH2;{pGlu}-QD-Y(SO3H)-TGWMDF-NH2.
  • HY-17386
    Rosiglitazone 122320-73-4 99.21%
    Rosiglitazone (BRL49653) is a potent thiazolidinedione insulin sensitizer. Rosiglitazone is a selective PPARγ agonist with EC50s of 30 nM, 100 nM and 60 nM for PPARγ1, PPARγ2, and PPARγ, respectively.
  • HY-P0035
    Insulin(human) 11061-68-0
    Argireline prevents formation of skin lines and wrinkles, inhibiting neurotransmitter release at the neuromuscular junction. Sequence: N-acetyl-Glu-Glu-Met-Gln-Arg-Arg-NH2;Ac-EEMQRR-NH2.
  • HY-13443
    Exendin-4 141758-74-9 98.96%
    Exendin-4, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2.
  • HY-50202
    Etomoxir 124083-20-1 99.40%
    Etomoxir ((R)-(+)-Etomoxir) is a potent inhibitor of carnitine palmitoyltransferase-I (CPT-1).
  • HY-100116A
    Mitoquinone mesylate 845959-50-4 >98.0%
    Mitoquinone mesylate is a TPP-based, mitochondrially targeted antioxidant.
    Mitoquinone mesylate
  • HY-16737
    Elafibranor 923978-27-2 99.31%
    Elafibranor is a PPARα/δ agonist with EC50s of 45 and 175 nM, respectively.
  • HY-15409
    Empagliflozin 864070-44-0 99.91%
    Empagliflozin is a selective sodium glucose cotransporter-2 (SGLT-2) inhibitor with an IC50 of 3.1 nM for human SGLT-2.
  • HY-50108
    GW 4064 278779-30-9 99.42%
    GW 4064 is a potent FXR agonist with EC50 of 65 nM.
    GW 4064
  • HY-16901
    Firsocostat 1434635-54-7 98.72%
    Firsocostat (ND-630; GS-0976; NDI-010976) is an acetyl-CoA carboxylase (ACC) inhibitor; inhibits human ACC1 and ACC2 with IC50 values of 2.1 and 6.1 nM, respectively.
  • HY-N0750
    Monocrotaline 315-22-0 >98.0%
    Monocrotaline is an pyrrolizidine alkaloid extracted from the seeds of the Crotalaria spectabilis plant to induce pulmonary hypertension in rodents.
  • HY-10450
    Dapagliflozin 461432-26-8 99.89%
    Dapagliflozin (BMS-512148) is a sodium-glucose co-transporter 2 (SGLT2) inhibitor for the treatment of type 2 diabetes.
  • HY-13992
    AP20187 195514-80-8 99.80%
    AP20187 (B/B Homodimerizer) is a cell-permeable ligand used to dimerize FK506-binding protein (FKBP) fusion proteins and initiate biological signaling cascades and gene expression or disrupt protein-protein interactions.
  • HY-10838
    GW 501516 317318-70-0 99.27%
    GW 501516 is a PPARδ agonist with an EC50 of 1.1 nM.
    GW 501516
  • HY-P0014
    Liraglutide 204656-20-2 99.96%
    Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-{N6-[N-(1-oxohexadecyl)-L-γ-Glutamyl]-Glu}-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly;HAEGTFTSDVSSYL-{N6-[N-(1-oxohexadecyl)-L-γ-Etamyl]-Glu}-GQAAKEFIAWLVRGRG.
  • HY-100596
    AS1842856 836620-48-5 98.09%
    AS1842856 is a potent and cell-permeable Foxo1 inhibitor with an IC50 of 30 nM.
  • HY-15145
    SRT 1720 Hydrochloride 1001645-58-4 99.92%
    SRT 1720 Hydrochloride is a selective activator of SIRT1 with an EC1.5 of 0.16 μM, and shows less potent activities on SIRT2 and SIRT3 with EC1.5s of 37 μM and 300 μM, respectively.
    SRT 1720 Hydrochloride
  • HY-15304
    Dynasore 304448-55-3 99.61%
    Dynasore is a cell-permeable dynamin inhibitor with an IC50 of 15 μM.
  • HY-B0285A
    Amiloride hydrochloride 2016-88-8 >98.0%
    Amiloride (hydrochloride) is an epithelial sodium channel (ENaC) inhibitor and a competitive inhibitor of Urokinase-type plasminogen activator (uPA).
    Amiloride hydrochloride
  • HY-10451
    Canagliflozin 842133-18-0 99.61%
    Canagliflozin is a selective SGLT2 inhibitor with IC50s of 2 nM, 3.7 nM, and 4.4 nM for mSGLT2, rSGLT2, and hSGLT2 in CHOK cells, respectively.