1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. Insulin(cattle)

Insulin(cattle)  (Synonyms: Insulin from bovine pancreas)

Cat. No.: HY-P1156 Purity: ≥98.0%
COA Handling Instructions

Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Insulin(cattle) Chemical Structure

Insulin(cattle) Chemical Structure

CAS No. : 11070-73-8

Size Price Stock Quantity
Free Sample (0.1 - 0.5 mg)   Apply Now  
10 mg USD 72 In-stock
Estimated Time of Arrival: December 31
25 mg USD 132 In-stock
Estimated Time of Arrival: December 31
50 mg USD 192 In-stock
Estimated Time of Arrival: December 31
100 mg USD 324 In-stock
Estimated Time of Arrival: December 31
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 4 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.

In Vitro

Two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates glucose uptake into muscle and fat cells by recruiting membrane glucose transporter Glut-4 to cell surface. Insulin cattle has often been used as growth supplement in culturing cells at the concentration ranging from 1 to 10 μg/mL of medium.

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5733.49

Appearance

Solid

Formula

C254H377N65O75S6

CAS No.
Sequence

Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'

Sequence Shortening

FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 10 mg/mL (1.74 mM; ultrasonic and warming and adjust pH to 3 with HCl and heat to 60°C)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1744 mL 0.8721 mL 1.7441 mL
5 mM --- --- ---
10 mM --- --- ---
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation

Purity: 98.60%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin(cattle)
Cat. No.:
HY-P1156
Quantity:
MCE Japan Authorized Agent: