1. Screening Libraries
  2. Bioactive Compound Library Plus

Bioactive Compound Library Plus

Cat. No.: HY-L001P
Library Contents: XLSX PDF

A unique collection of 7129 bioactive compounds including natural products, enzyme inhibitors, receptor ligands, and drugs for high throughput screening (HTS) and high content screening (HCS).

The library consists of HY-L001 (Part A), compounds with low solubility or stability (Part B) and novel or rare compounds (Part C).

Bioactive Compound Library Plus
Size (Pre-dissolved DMSO or Solid) Price Stock
30 μL/well (10 mM solution) Get quote In-stock
50 μL/well (10 mM solution) Get quote In-stock
100 μL/well (10 mM solution) Get quote In-stock
250 μL/well (10 mM solution) Get quote In-stock

Please contact us at

[email protected]

Top Publications Citing Use of Products
  • Description

  • Product Details

  • Composition

  • Contents

  • Documentation

Description
& Advantages

•   Bioactivity and safety confirmed by preclinical research and clinical trials. Some have been approved by FDA.

•   Widely used in the research focus areas such as Cancer, Stem Cell, Neuronal Signaling, Immunity, and more.

•   Structurally diverse, medicinally active, and cell permeable.

•   More detailed compound information with structure, IC50, and other chemical & biological data.

•   NMR and HPLC validated to ensure high purity and quality.

•   All compounds are in stock and continuously updated.

  Part A Part B Part C
Number 5077 610 1442
Feature General compounds (HY-L001) Compounds with low solubility or stability Novel, rare or exclusive compounds
Package Solution (10 mM) or solid (1 mg) Only solid (1 mg) Only solid (1 mg)
Product Details
Formulation:
A collection of 7129 bioactive compounds supplied as pre-dissolved DMSO solutions or Solid
Container:
96 Well Format Sample Storage Tube With Screw Cap and Optional 2D Barcode
Storage:
-80°C
Shipping:
Blue ice
Composition

Bioactive Compound Library Plus

Source: MedChem Express

Contents of Bioactive Compound Library Plus

Plate layout: HY-L001P-Part A-1

1 2 3 4 5 6 7 8 9 10 11 12
a Empty SKF-96365 (hydrochloride) MRT68921 (hydrochloride) Vonoprazan Ufenamate CBR-5884 Mivebresib AZD0156 BAY-876 BAY-1436032 LY3177833 Empty
b Empty HLCL-61 (hydrochloride) Ro 41-1049 (hydrochloride) PD 117519 NSC 663284 MK-4101 NT157 YYA-021 Faropenem daloxate Flavopiridol Flavopiridol (Hydrochloride) Empty
c Empty NPS-2143 SNS-032 Semagacestat Ko 143 KNK437 GLX351322 TA-01 AZD-5438 Tubercidin JNJ-17203212 Empty
d Empty Taranabant GSK'481 R547 Pipequaline Pirozadil PAP-1 4-IBP BAPTA Toll-like receptor modulator Delpazolid Empty
e Empty Methoxatin (disodium salt) SMER28 TPEN HC-067047 Sufugolix EAI045 Biotin Hydrazide RSL3 (1S,3R-) GSK6853 AM-2394 Empty
f Empty ME0328 SKF89976A (hydrochloride) IQ-1 DREADD agonist 21 EPZ015866 Madrasin SZL P1-41 Nutlin (3a) WWL70 GSK583 Empty
g Empty SRI-011381 (hydrochloride) BI-7273 BI-9564 CL-82198 MS049 Remetinostat Lu AF21934 DMCM (hydrochloride) MK591 (free acid) MRK-016 Empty
h Empty (RS)-MCPG Valrocemide A 922500 BH3I-1 NKL 22 Brevianamide F NVP-BAW2881 F16 SQ22536 PF-04979064 Empty

Plate layout: HY-L001P-Part A-2

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Ro 67-7476 (S)-MCPG JNJ16259685 PHCCC FCCP MLi-2 LY2365109 (hydrochloride) Odanacatib CPI-455 Imazamox Empty
b Empty CCF642 Cadazolid HA15 WYE-132 TM5275 (sodium) AEE788 TCS-OX2-29 HO-3867 ZL006 Plerixafor Empty
c Empty TPI-1 Visomitin CPI-637 A-804598 Bay 59-3074 TBHQ BP-1-102 GSK2256098 Tyrphostin AG 528 CID5721353 Empty
d Empty ITSA-1 NPS-1034 RAF709 Benzophenonetetracarboxylic acid Benzenepentacarboxylic Acid GSK484 NVS-PAK1-1 Aprepitant ML385 Nanchangmycin Empty
e Empty PD150606 CD437 INH6 D-alpha-Hydroxyglutaric acid (disodium salt) GSK-LSD1 Dihydrochloride MSDC 0160 SecinH3 Tempol Flopropione Cyclo(RGDyK) trifluoroacetate Empty
f Empty (E)-Necrosulfonamide NH125 AGK2 Ferrostatin-1 Ribitol (-)-(S)-Equol (±)-Equol D-Glutamine VU0364770 Nicaraven Empty
g Empty Spiramycin Stibogluconate (sodium) AS1842856 Urolithin A HJC0152 hydrochloride CaCCinh-A01 AS1517499 BVT948 APS-2-79 Ticagrelor Empty
h Empty AZD5153 (6-Hydroxy-2-naphthoic acid) Fosfluconazole Y-33075 LM22A-4 U93631 Y-33075 (dihydrochloride) SYP-5 NSC632839 Y-27632 D-AP5 Empty

Plate layout: HY-L001P-Part A-3

1 2 3 4 5 6 7 8 9 10 11 12
a Empty IPI549 GSK2193874 Cambinol Histone Acetyltransferase Inhibitor II C 87 ML348 ML349 Ubiquitin Isopeptidase Inhibitor I, G5 RA190 TPCA-1 Empty
b Empty AS8351 STF-62247 PSB-12379 Norverapamil (hydrochloride) PF-06651600 HTHQ YL0919 IDO-IN-2 gamma-DGG 2-PMPA Empty
c Empty CHS-828 Ciliobrevin A NSC23005 (sodium) URB602 SR12813 Hypotaurine D-Glutamic acid Kynurenic acid Quinolinic acid (R)-Serine Empty
d Empty Isoguvacine (hydrochloride) 7-Chloro-4-hydroxyquinoline-2-carboxylic acid 7-Chlorokynurenic acid sodium salt Triapine BGP-15 NCB-0846 YM-58483 UNC3866 Antibiotic-5d Piperoxan (hydrochloride) Empty
e Empty TAK-659 (hydrochloride) Navitoclax WT-161 KRIBB11 GCN2-IN-1 Zibotentan TUG-891 ONO-7300243 SAR-20347 CDD3505 Empty
f Empty CCCP Conduritol B epoxide CEP-40783 Beaucage reagent Diphenyleneiodonium chloride TB5 HA-100 10074-G5 NPPB MK-8617 Empty
g Empty RIPA-56 Sarcosine ZK756326 (dihydrochloride) AR-M 1000390 (hydrochloride) Src Inhibitor 1 NQ301 Kinetin riboside TOFA Salermide LY294002 Empty
h Empty SKL2001 CeMMEC13 AS-605240 KYA1797K Importazole Ocaperidone IC-87114 SB-224289 hydrochloride AR7 Allopregnanolone Empty

Plate layout: HY-L001P-Part A-4

1 2 3 4 5 6 7 8 9 10 11 12
a Empty TG100-115 EED226 666-15 TP-3654 Bicyclomycin benzoate PNU-74654 TGX-221 PI-103 (Hydrochloride) Naltrindole (hydrochloride) Vorapaxar Empty
b Empty GSK682753A GJ103 (sodium salt) UK-371804 Org-26576 Silodosin DHBP (dibromide) Agmatine (sulfate) XMD16-5 ZINC00881524 Barasertib-HQPA Empty
c Empty AZD1152 STK16-IN-1 WAY-200070 GDC-0326 Vadadustat ST034307 ZM-447439 DMU2139 Veliparib Iberdomide Empty
d Empty TPPU PD-166866 Paprotrain Veliparib (dihydrochloride) Cilostamide Phenylbiguanide RS 17053 hydrochloride ZD7288 Hesperin PF-01247324 Empty
e Empty Ro 10-5824 (dihydrochloride) Picrotoxin ICA-069673 Deoxycytidine triphosphate 3-(Methylthio)propionic acid Cyclo(his-pro) N-(5-Aminopentyl)acetamide Gestrinone Nicotinamide N-oxide Docosatrienoic Acid Empty
f Empty O-Acetylserine SDMA 4-Acetamidobutanoic acid 2-(Methylamino)-1H-purin-6(7H)-one Iberin L-DABA Vanilpyruvic acid Diethyl phosphate CYM-5541 VUF10460 Empty
g Empty GAL-021 NIH-12848 RG14620 Bamaquimast NS-638 RG13022 PGD2-IN-1 SR9238 ISCK03 PAβN (dihydrochloride) Empty
h Empty Trolox SR0987 CDN1163 IT1t (dihydrochloride) RAD51 Inhibitor B02 ML329 SIRT2 Inhibitor II Emodepside Ibuprofen piconol LF3 Empty

Plate layout: HY-L001P-Part A-5

1 2 3 4 5 6 7 8 9 10 11 12
a Empty SR-18292 GPR120-IN-1 SUN11602 MT-DADMe-ImmA SB290157 (trifluoroacetate) HTS01037 2,4,6-Tribromophenyl caproate Polyoxyethylene stearate Docosahexaenoic Acid methyl ester HI-TOPK-032 Empty
b Empty BMS-986205 GSK3326595 BAY-1895344 (hydrochloride) M3814 Gefapixant Nilotinib Nilotinib (monohydrochloride monohydrate) Tozasertib MSC2530818 Olaparib Empty
c Empty Ilaprazole LTURM34 NPS-2143 (hydrochloride) TRC051384 Oxyphenisatin acetate IMD-0354 AMG9810 TM5441 Btk inhibitor 2 UAMC00039 (dihydrochloride) Empty
d Empty BTB-1 (2-Chloropyridin-4-yl)methanamine hydrochloride GLPG1690 ML311 PHA-680632 Danusertib 2-(Pyridyldithio)ethylamine (hydrochloride) Veralipride MLN8054 Dasatinib Empty
e Empty Dasatinib (hydrochloride) CHIR-99021 CHIR-99021 (monohydrochloride) SBC-110736 DKM 2-93 dBET1 ML213 STAT5-IN-1 Anle138b BQCA Empty
f Empty GIBH-130 Miridesap CB-7921220 AVex-73 hydrochloride GSK'872 Acridine Orange (hydrochloride) Biocytin Calcein Blue Dabsyl chloride Nile Blue A (sulfate) Empty
g Empty BMS-309403 DC260126 Linsitinib PSB-12062 NVP-TAE 684 Autophinib LYN-1604 hydrochloride AZD-1480 YM-155 BTK IN-1 Empty
h Empty SMI-16a Prostaglandin E2 NCT-503 Wortmannin Navarixin AZD4635 BMS-754807 Rucaparib (Camsylate) Sorafenib BT-11 Empty

Plate layout: HY-L001P-Part A-6

1 2 3 4 5 6 7 8 9 10 11 12
a Empty RN-18 6-Biopterin Sorafenib (Tosylate) Tandutinib RG3039 FX1 KY1220 (RS)-Butyryltimolol OSI-930 Cediranib Empty
b Empty WM-1119 Amuvatinib Dovitinib (lactate) Pazopanib Masitinib Masitinib (mesylate) Tanespimycin BIIB021 Luminespib Vorinostat Empty
c Empty CUDC-101 Panobinostat Belinostat Bortezomib Motesanib Motesanib (Diphosphate) PX-478 Saracatinib Telaprevir Boceprevir Empty
d Empty Danoprevir Mericitabine Simeprevir BRAF inhibitor RAF265 GSK-690693 NVP-ADW742 AG1024 PD0325901 Sunitinib Empty
e Empty SB 203580 BAY 11-7085 PD 123319 (ditrifluoroacetate) Vandetanib Afatinib Afatinib (dimaleate) BMS-536924 Betrixaban Dabigatran etexilate Dabigatran etexilate (mesylate) Empty
f Empty Linagliptin Saxagliptin Tarenflurbil SB 202190 Omipalisib GSK-923295 NAI-N3 TC-G-1008 MK-3207 (Hydrochloride) BAY-1816032 Empty
g Empty LY3200882 Repotrectinib PIK-294 BET bromodomain inhibitor ML-030 Diethyl-pythiDC FIN56 E7046 AAI101 R162 Empty
h Empty ST271 SB-399885 hydrochloride LY334370 ABT-702 dihydrochloride 5'-N-Ethylcarboxamidoadenosine MRS-1706 Doramapimod PD173074 Falnidamol GYKI53655 hydrochloride Empty

Plate layout: HY-L001P-Part A-7

1 2 3 4 5 6 7 8 9 10 11 12
a Empty D4476 CL-387785 ML221 GW788388 Neflamapimod JNJ-7706621 KG-501 Regorafenib Bepridil hydrochloride Regorafenib (monohydrate) Empty
b Empty Brivanib (alaninate) SB297006 Brivanib Foretinib 1-Aminobenzotriazole KW-2449 Stiripentol Methylmalonate KX2-391 (dihydrochloride) KX2-391 (Mesylate) Empty
c Empty Fasudil (Hydrochloride) Enzastaurin Sotrastaurin AZD 6482 PHTPP WAY-100635 Maleate Raltegravir CGP52432 Gabazine Raltegravir (potassium salt) Empty
d Empty BETP AKT inhibitor VIII LGD-3303 MK 2206 (dihydrochloride) E3 ligase Ligand-Linker Conjugates 7 Free Base 4,4'-Dimethoxybenzil PKM2-IN-1 THZ531 3-Methoxytyramine hydrochloride 3-Methoxytyramine Empty
e Empty WR-1065 dihydrochloride BI-78D3 EED inhibitor-1 Fmoc-1,6-diaminohexane 2-HBA Canertinib (dihydrochloride) PF-06726304 PF-06409577 Gardiquimod trifluoroacetate iCRT3 Empty
f Empty ROC-325 Pim1/AKK1-IN-1 IBR2 PP121 Trimetrexate Semaxinib Sutezolid PD173955 CTS-1027 Fmoc-Ser(O-α-D-GalNAc(OAc)3)-OH Empty
g Empty ML335 VX-702 Losmapimod SPB L-Kynurenine BAY 73-6691 racemate PH-797804 Ac-CoA Synthase Inhibitor1 LTI-291 Pamiparib Empty
h Empty Lanifibranor Talmapimod 1A-116 SU 5402 CAY10602 Pocapavir Fedratinib TG101209 MK-2894 MK-2894 (sodium salt) Empty

Plate layout: HY-L001P-Part A-8

1 2 3 4 5 6 7 8 9 10 11 12
a Empty AH 6809 AZD-8055 Milciclib XCT790 SB-431542 A 83-01 sodium salt SKF-82958 (hydrobromide) HPGDS inhibitor 1 Vismodegib Pralatrexate Empty
b Empty Capsaicin Dapagliflozin Dapagliflozin ((2S)-1,2-propanediol, hydrate) Canagliflozin Ixazomib citrate Ixazomib Delanzomib Carfilzomib TAK-715 PF-562271 (besylate) Empty
c Empty PF-562271 PF-573228 Daclatasvir (dihydrochloride) Daclatasvir NM107 GSK256066 LY2811376 Torkinib AM580 Fasiglifam Empty
d Empty JDTic (dihydrochloride) Dinaciclib Cobicistat BMS-794833 Lexibulin Secoisolariciresinol diglucoside SU14813 SU14813 (maleate) Tipifarnib Orteronel Empty
e Empty BI-D1870 Fantofarone AR-A014418 BX795 Orantinib BMS-345541 BMS-345541 (free base) CGP 57380 Darapladib GSK1904529A Empty
f Empty Telatinib Tasquinimod Betulinic acid ARRY-380 (analog ) GW 5074 Tegobuvir Tariquidar Tariquidar (methanesulfonate, hydrate) CYC-116 RU 58841 Empty
g Empty Ketanserin Ketanserin (tartrate) Sarpogrelate (hydrochloride) Ponesimod Nevirapine Delavirdine (mesylate) Efavirenz Rilpivirine PD 169316 Pluripotin Empty
h Empty GSK 3 Inhibitor IX Flurbiprofen Y-27632 (dihydrochloride) Valproic acid Valproic acid (sodium salt) 5-Azacytidine BIX-01294 TWS119 Neuropathiazol IQ 1 Empty

Plate layout: HY-L001P-Part A-9

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Lexithromycin Ro 28-1675 Alagebrium chloride A-966492 Eniporide hydrochloride Rucaparib (phosphate) Niraparib Niraparib tosylate T0901317 GW3965 (hydrochloride) Empty
b Empty LXR-623 SB-705498 AMG 517 Palosuran BMS-687453 MK-6892 Pridopidine Ningetinib Tosylate Ningetinib β-Cyclodextrin Empty
c Empty Selamectin Almitrine mesylate Sulcotrione 4-Butylresorcinol 6-Bromo-2-hydroxy-3-methoxybenzaldehyde Uridine triphosphate β-Chloro-L-alanine Benzo[a]pyrene L-Valyl-L-phenylalanine AKR1C3-IN-1 Empty
d Empty Tetrahydrobiopterin Asimadoline BAY-299 Oxythiamine OSS_128167 YK11 UVI 3003 VU 0365114 SN 6 Desformylflustrabromine hydrochloride Empty
e Empty CGP71683 hydrochloride LY2955303 Fluensulfone PF-9366 Methiothepin mesylate 2-Phospho-L-ascorbic acid trisodium salt Cilomilast CJ-42794 GNE-6776 EG00229 Empty
f Empty Aminooxyacetic acid hemihydrochloride Mirogabalin besylate CCT 137690 Almorexant Almorexant (hydrochloride) Bitopertin Pemetrexed Pemetrexed (disodium) Raltitrexed Tomeglovir Empty
g Empty 6-Aminochrysene DPP-IV-IN-2 Teijin compound 1 (Z)-Thiothixene Brequinar AM-0902 AG126 3-TYP Cruzain-IN-1 CCG-203971 Empty
h Empty Gamithromycin N33-TEG-COOH PROTAC Linker 1 PROTAC Linker 2 GW 501516 Talazoparib tosylate (R)-Equol Pretomanid WS-12 Delamanid Empty

Plate layout: HY-L001P-Part A-10

1 2 3 4 5 6 7 8 9 10 11 12
a Empty A-967079 Pyr3 CU CPT 22 URB-597 LY2183240 GSK2033 Otenabant TDCPP NGP555 LRRK2-IN-1 Empty
b Empty Clotrimazole Istradefylline Preladenant RO1138452 Sabinene SB-334867 (free base) SB-674042 TCS 1102 Apararenone Tucidinostat Empty
c Empty Tapinarof Lazertinib Cilofexor Edicotinib Parimifasor Fexaramine UCPH-101 GW2580 UNC0224 UNC0321 Empty
d Empty Aniracetam Ampalex Farampator Pifithrin-μ VER-155008 VER-82576 GNF-7 FLT3-IN-1 BRL-50481 RG7112 Empty
e Empty Arachidonic acid Momelotinib D4-abiraterone Momelotinib sulfate Vadimezan Ethylhexyl triazone Diethylamino hydroxybenzoyl hexyl benzoate SB-590885 Obatoclax Alisertib Empty
f Empty MK-0752 Tivozanib Crisaborole Tavaborole Lenvatinib Amonafide Pomalidomide ENMD-2076 (Tartrate) ENMD-2076 Abexinostat Empty
g Empty MGCD-265 analog AZD-7762 Adavosertib Tozadenant KHS101 hydrochloride Ibrutinib Trametinib Trametinib (DMSO solvate) GSK429286A (+)-PD 128907 hydrochloride Empty
h Empty PHA-793887 CP-466722 GW843682X AZ 628 BX-912 KU-57788 GNF-2 IP3K Inhibitor CGP60474 (±)-CPSI-1306 Empty

Plate layout: HY-L001P-Part A-11

1 2 3 4 5 6 7 8 9 10 11 12
a Empty A-484954 TDZD-8 Rivastigmine (tartrate) R-7050 DFHBI MK-0773 BAM 15 CVT-12012 WAY-262611 Pitofenone hydrochloride Empty
b Empty GR148672X NS11394 TH-237A Icilin Fingolimod WHI-P97 SB 239063 A-803467 TMC353121 Asenapine (maleate) Empty
c Empty Alendronate (sodium hydrate) RO4929097 Sitaxsentan (sodium) Pilaralisib analogue Nintedanib esylate PHA-665752 R406 (free base) Resatorvid 3-Methyltoxoflavin CZC-8004 Empty
d Empty Diprotin A (TFA) Pyributicarb Aftin-4 HAMNO AZD5904 HDAC8-IN-1 ONC212 1-Linoleoyl Glycerol Tinoridine hydrochloride PF-05180999 Empty
e Empty NMDI14 LX2343 SEL120-34A (monohydrochloride) Resazurin sodium salt ALB-127158(a) SR-4370 EOAI3402143 EBI-2511 PLX51107 SSE15206 Empty
f Empty 1-Ethynylnaphthalene p-Methylphenyl potassium sulfate 1,4-Chrysenequinone Auxinole CeMMEC1 LP-211 BAY-678 SM 16 Desisobutyryl-ciclesonide DIM-C-pPhOCH3 Empty
g Empty GSTO1-IN-1 Mitochonic acid 5 IACS-10759 IACS-10759 Hydrochloride CU-CPT-8m CU-CPT-9b Saccharin 1-methylimidazole 8-OH-DPAT CIL56 Chlorcyclizine (hydrochloride) Empty
h Empty 13-cis-N-[4-(Ethoxycarbonyl)phenyl]retinamide N-Bis(2-hydroxypropyl)nitrosamine GSK2200150A eCF506 Prohydrojasmon racemate 6-(γ,γ-Dimethylallylamino)purine Meta-Topolin Diethyl aminoethyl hexanoate citrate Folcisteine SLV-2436 Empty

Plate layout: HY-L001P-Part A-12

1 2 3 4 5 6 7 8 9 10 11 12
a Empty KRN2 (bromide) Palmitodiolein AB-423 ZL0420 NSC139021 BMS-986195 GDC-0575 γ-L-Glutamyl-L-alanine Prolylleucine N-Acetylhistamine Empty
b Empty PKG drug G1 VU0467154 ARQ 531 O-304 ACP-105 Beryllon II C188-9 AZ32 SJ000291942 ETC-206 Empty
c Empty NAV-2729 PROTAC Linker 4 1,2-Distearoyl-sn-glycero-3-phosphorylethanolamine S119-8 AZ3451 JNJ-632 MBX-4132 E3 Ligase Ligand-Linker Conjugates 22 E3 Ligase Ligand-Linker Conjugates 23 (TFA) E3 Ligase Ligand-Linker Conjugates 24 (TFA) Empty
d Empty E3 Ligase Ligand-Linker Conjugates 25 Trifluoroacetate MS21570 CAY 10465 PDM2 CU-CPT-9a Retagliptin Phosphate 5-Chloro-2'-deoxyuridine Exo1 4-Octyl Itaconate H-Arg-4MβNA Empty
e Empty LIT-927 HC-056456 PEO-IAA TFAP Hexadimethrine bromide DLinDMA BN82002 (+)-JQ1 PA Chlorantraniliprole MBQ-167 Empty
f Empty IITZ-01 XRK3F2 C-176 MLS0315771 Maltotriose Elaidic acid N-Acetylornithine 1-Methyladenosine 25-Hydroxycholesterol 5-Methylcytidine Empty
g Empty Galactose 1-phosphate Potassium salt Asymmetric dimethylarginine p-Synephrine trans-trans-Muconic acid (3-Carboxypropyl)trimethylammonium chloride 3-Methyladipic acid Leucyl-phenylalanine Ureidopropionic acid 4-Guanidinobutanoic acid Citraconic acid Empty
h Empty Nicotinuric acid Anserine Petroselinic acid Guanidinosuccinic acid N-Methylhydantoin DL-Dopa 3-Hydroxyisovaleric acid 3-Methylglutaric acid Nepsilon-Acetyl-L-lysine N-Acetyl-L-aspartic acid Empty

Plate layout: HY-L001P-Part A-13

1 2 3 4 5 6 7 8 9 10 11 12
a Empty H4 Receptor antagonist 1 CID 1375606 H-Val-Pro-Pro-OH (TFA) DJ-V-159 2-D08 LY2452473 ELN484228 Parbendazole INH154 (S)-Metolachor Empty
b Empty JQ-35, (S)- NGI-1 ABX-1431 Dansylamide CGI-1746 AG-490 SNS-314 Fingolimod (hydrochloride) Erlotinib (Hydrochloride) Pazopanib (Hydrochloride) Empty
c Empty BMS-599626 (Hydrochloride) HA14-1 PD153035 (Hydrochloride) SU11274 Iniparib KU-55933 PF-04217903 PF-04217903 (methanesulfonate) Vatalanib (dihydrochloride) SGX-523 Empty
d Empty TW-37 3-Aminobenzamide Andarine Alvespimycin (hydrochloride) Serdemetan WZ4002 PD98059 U0126 AG14361 2-Methoxyestradiol Empty
e Empty WYE-354 AMG-208 GSK1059615 Rigosertib (sodium) Ki8751 Lyn-IN-1 Elesclomol SP600125 Pimasertib SB 525334 Empty
f Empty Cabozantinib (S-malate) HMN-214 PIK-93 Ponatinib Chelerythrine Chloride CCT129202 CP-673451 Vinorelbine (ditartrate) Hesperadin BIX02188 Empty
g Empty BIX02189 Vemurafenib AZD8330 AT7867 AT7867 (dihydrochloride) KRN-633 KU-60019 PD318088 PHT-427 GSK1292263 Empty
h Empty R406 PI3K-IN-1 SB-743921 DPH LDN193189 (Hydrochloride) Lck Inhibitor BMS 777607 BX471 Apremilast Torcetrapib Empty

Plate layout: HY-L001P-Part A-14

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Anacetrapib BMS-564929 Oprozomib Poloxin Volasertib A-867744 NS 1738 PNU-120596 VU 0238429 Entinostat Empty
b Empty Mocetinostat Aliskiren Aliskiren (hemifumarate) JNJ-5207852 ABT-239 Pitolisant (hydrochloride) PFK-158 PFK-015 RTA-408 Lorlatinib Empty
c Empty MGL-3196 MM-102 (TFA) INT-747 PI-3065 IWR-1 CID755673 GBR 12935 (dihydrochloride) SB-366791 XEN445 Telaglenastat Empty
d Empty T-5224 DMH-1 ML347 FR 180204 MI 2 AZ191 K02288 Umbralisib FPH2 Rostafuroxin Empty
e Empty Serabelisib YH239-EE Ozanimod Defactinib Defactinib (hydrochloride) Arg-Gly-Asp-Ser IM-12 PEAQX (tetrasodium hydrate) GKT137831 WH-4-023 Empty
f Empty CFI-400945 (free base) CFI-400945 (fumarate) MK-3697 Kenpaullone OAC1 IOX1 TCS 401 IBMX Cardiogenol C (hydrochloride) Cycloheximide Empty
g Empty ISX-9 GSK2194069 AZD8186 KRCA-0008 HTH-01-015 UNC0379 ML277 UNC2025 UNC2025 (hydrochloride) FH1 Empty
h Empty Ro 61-8048 Pimodivir SB-3CT Siponimod ETC-1002 C75 C75 (trans) Namodenoson BAY 41-2272 GSK0660 Empty

Plate layout: HY-L001P-Part A-15

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Atipamezole (hydrochloride) Atipamezole Aminothiazole SBC-115076 Angiotensin (1-7) 6H05 (trifluoroacetate) PFI-3 E7449 Gilteritinib G007-LK Empty
b Empty Y15 SPDB DPN WS6 WS3 Decernotinib PF-4800567 Balipodect PF-06447475 SAR405 Empty
c Empty LY-2584702 (tosylate salt) LDC1267 ISRIB (trans-isomer) NS-1619 ANA-12 Efonidipine (hydrochloride monoethanolate) CFM-2 Pyr6 Naspm Naspm (trihydrochloride) Empty
d Empty GSK-7975A PEPA SKF-86002 LY3023414 Nicardipine (Hydrochloride) Desogestrel OF-1 Oltipraz SKF 38393 (hydrochloride) Bikinin Empty
e Empty Ro-3306 Velpatasvir Dantrolene (sodium hemiheptahydrate) Terlipressin Gonadorelin (acetate) LY3009120 PNU-282987 A-366 Thiamet G ZM39923 (hydrochloride) Empty
f Empty D-Luciferin (sodium salt) D-Luciferin D-Luciferin potassium salt GS967 URMC-099 AZD5582 ON123300 SP2509 Hexachlorophene Dichlorophen Empty
g Empty Bephenium (hydroxynaphthoate) Pyrantel (pamoate) Pyrantel (tartrate) Diethylcarbamazine (citrate) Eprinomectin Acalisib Y16 Primaquine (Diphosphate) LDC4297 AF64394 Empty
h Empty Entrectinib CCT251545 Glutaminase C-IN-1 BPTES CH-223191 Tizoxanide DO3A tert-Butyl ester R(+)-IAA-94 Prucalopride (succinate) 10058-F4 Empty

Plate layout: HY-L001P-Part A-16

1 2 3 4 5 6 7 8 9 10 11 12
a Empty ITD-1 Bromocriptine (mesylate) Piribedil Rauwolscine (hydrochloride) ML324 Liproxstatin-1 Lotamilast LDN-212320 SCR7 K-7174 (dihydrochloride) Empty
b Empty Genz-123346 (free base) AZD3965 Trimethobenzamide hydrochloride Alimemazine hemitartrate ML228 ML141 YHO-13177 YHO-13351 (free base) QS11 GNE-317 Empty
c Empty BLZ945 IC261 Cyantraniliprole ORY-1001(trans) L-779450 Vps34-PIK-III Vps34-IN-1 VAS2870 ML171 FIPI Empty
d Empty STF-118804 Optovin EHop-016 TH588 MCC950 (sodium) AEBSF BLU9931 JNJ-42041935 MK2-IN-1 (hydrochloride) IFN alpha-IFNAR-IN-1 (hydrochloride) Empty
e Empty Mirk-IN-1 OBA-09 CCT196969 Lys01 (trihydrochloride) GSK503 BAY1217389 CB-5083 Larotrectinib sulfate Bimiralisib AZD-8835 Empty
f Empty AZD9496 AZD9496 (maleate) RBC8 CASIN BQU57 Eliprodil Ifenprodil (tartrate) OAC2 Macozinone PF-05175157 Empty
g Empty AMG319 ML204 ML204 (hydrochloride) PTACH Dinoprost (tromethamine salt) Bretylium (tosylate) TP-0903 SGI-7079 S49076 PRT-060318 Empty
h Empty AZ6102 Batefenterol Pimozide Spautin-1 RSV604 RSV604 (racemate) Quizartinib Torin 2 PF-3758309 MK-0354 Empty

Plate layout: HY-L001P-Part A-17

1 2 3 4 5 6 7 8 9 10 11 12
a Empty PF-04620110 Laquinimod Alectinib Alectinib Hydrochloride RepSox SIS3 Cabozantinib Ivacaftor MRT67307 GSK1838705A Empty
b Empty SRT3190 CC-401 (hydrochloride) Rebastinib Idelalisib DAPT (+)-JQ-1 (R)-(-)-JQ1 Enantiomer Molibresib Gandotinib Fostamatinib Disodium Empty
c Empty Fostamatinib disodium hexahydrate ADL-5859 Cediranib (maleate) Sapitinib Telotristat etiprate Telotristat ethyl SMND-309 ADX-47273 (R)-ADX-47273 SDZ 220-581 Empty
d Empty SDZ 220-581 (hydrochloride) ACHP (Hydrochloride) Daunorubicin (Hydrochloride) Cobimetinib Cobimetinib (hemifumarate) Isobavachalcone Tripterin Golvatinib Nestoron VO-Ohpic (trihydrate) Empty
e Empty CHIR-98014 MRS 2578 WAY-100635 (maleate salt) CGS 21680 (Hydrochloride) T0070907 NVP-TAE 226 Biperiden (Hydrochloride) Belnacasan MTEP (hydrochloride) ONX-0914 Empty
f Empty Ambrisentan Zanamivir (E)-2-Decenoic acid AM211 Avasimibe Vanoxerine (dihydrochloride) BRL 54443 BAN ORL 24 Crenolanib Rivanicline hemioxalate Empty
g Empty Galunisertib SD-208 YM-201636 CDK9-IN-1 Talabostat (mesylate) Rifaximin I-BET151 GSK2578215A Dolutegravir Dolutegravir (sodium) Empty
h Empty LY2886721 Ralimetinib dimesylate Taladegib Disufenton sodium PF-4136309 Apitolisib MK-5108 AMG 900 TAME TAME hydrochloride Empty

Plate layout: HY-L001P-Part A-18

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Desmethyl Erlotinib Thiazovivin NVP-BHG712 CCT128930 A66 Lumacaftor CHIR-124 Degrasyn BS-181 Droxinostat Empty
b Empty BMS-707035 ABT-751 Tubastatin A (Hydrochloride) Tubastatin-A Dacomitinib IRAK inhibitor 1 IRAK inhibitor 2 IRAK inhibitor 3 IRAK inhibitor 6 PIK-75 Empty
c Empty GANT 58 MF63 Ki16425 SGI-1776 Org 27569 Nepicastat (hydrochloride) KN-62 WIN 55,212-2 (Mesylate) Vinpocetine PYR-41 Empty
d Empty PYZD-4409 Mps1-IN-1 SR-3677 LY2874455 JK184 Regorafenib (Hydrochloride) Infigratinib Infigratinib phosphate Montelukast (sodium) Mitomycin C Empty
e Empty Oseltamivir (acid) JNK-IN-8 Anguizole Pracinostat CX-5416 hydrochloride Bardoxolone (methyl) ASP3026 Evacetrapib Sapanisertib IRAK-1-4 Inhibitor I Empty
f Empty AZD4547 Cortexolone 17 alpha-propionate NVP-BGT226 Imisopasem manganese VU0152100 Apatinib ZM 336372 PF-8380 Varespladib Capmatinib Empty
g Empty TAK-779 SB 242084 SB 242084 (hydrochloride) Xanomeline (oxalate) Tofogliflozin (hydrate) AICAR AICAR (phosphate) Dorsomorphin (dihydrochloride) Zebularine SR1001 Empty
h Empty Zatebradine (hydrochloride) Zatebradine Tenovin-1 RITA Deguelin Roxadustat SR144528 (-)-Blebbistatin PF429242 (dihydrochloride) Nedocromil Empty

Plate layout: HY-L001P-Part A-19

1 2 3 4 5 6 7 8 9 10 11 12
a Empty TAK-733 CID-1067700 BAY 11-7082 CID 2011756 PF-5274857 PHA-767491 (hydrochloride) LY-364947 ALK-IN-1 KW-2478 Debio 0932 Empty
b Empty GSK126 HG-10-102-01 GNF-5837 ML281 GSK343 Mubritinib Mitoxantrone Mitoxantrone (dihydrochloride) M344 JNJ-7777120 Empty
c Empty Cutamesine dihydrochloride Rupatadine (Fumarate) Camostat (mesylate) U-104 Sirtinol Piceatannol TRAM-34 Nocodazole SB-505124 Fimepinostat Empty
d Empty PAC-1 AG-1478 YO-01027 LY310762 Clinofibrate CAY10505 AS-252424 Abarelix AZD-2461 BPR1J-097 Hydrochloride Empty
e Empty Gemcitabine (elaidate) ADH-1 trifluoroacetate Uramustine Amsacrine Anidulafungin β-Lapachone Ascomycin AZM475271 Banoxantrone (dihydrochloride) Belotecan (hydrochloride) Empty
f Empty Betamethasone Betamethasone dipropionate Beclometasone dipropionate Biapenem Oclacitinib (maleate) Brivudine BTZ043 BTZ043 Racemate Budesonide Carbendazim Empty
g Empty Carmustine Cefsulodin (sodium) Chlorambucil Chrysophanol Cisatracurium (besylate) Cladribine Clobetasol propionate Cytarabine Dacinostat Deflazacort Empty
h Empty Dutasteride Efaproxiral Efaproxiral (sodium) Entecavir (monohydrate) Epirubicin (hydrochloride) Ertapenem sodium Estramustine (phosphate sodium) Etoposide Exemestane Ezatiostat Empty

Plate layout: HY-L001P-Part A-20

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Finasteride Fulvestrant Ganciclovir GDC-0152 RG108 Daminozide HM30181 HM30181 mesylate HMN-176 (-)-Epigallocatechin Gallate Empty
b Empty Lansoprazole Leuprolide Acetate Levamisole (hydrochloride) Levoleucovorin (Calcium) Lomeguatrib Lomustine LW6 Goserelin (acetate) Megestrol (Acetate) 6-Mercaptopurine hydrate Empty
c Empty Meropenem (trihydrate) Mesna Mifepristone PQ401 IKK 16 PJ34 (hydrochloride) PJ34 Go 6983 Mitotane Mometasone furoate Empty
d Empty Methionine MSX-122 Nedaplatin Nelarabine SN-38 Norepinephrine (bitartrate monohydrate) Noscapine Oglufanide Pergolide (mesylate) HPPH Empty
e Empty Pimecrolimus Pirarubicin (Hydrochloride) Pixantrone (dimaleate) Procarbazine (Hydrochloride) PX-12 Quinacrine (dihydrochloride) l-Atabrine dihydrochloride d-Atabrine dihydrochloride R1530 Raloxifene (hydrochloride) Empty
f Empty Resiquimod Roquinimex Sardomozide dihydrochloride Silibinin Sitagliptin Sitagliptin (phosphate monohydrate) Sulforaphane Tacrolimus (monohydrate) Tamoxifen (Citrate) Tamoxifen Empty
g Empty TAS-103 (dihydrochloride) Teniposide 6-Thioguanine Tirapazamine Topotecan (Hydrochloride) TPT-260 (Dihydrochloride) Ursodiol Valrubicin Motolimod Zoledronic acid (monohydrate) Empty
h Empty J-147 Vinblastine (sulfate) Pemetrexed (disodium hemipenta hydrate) Tenofovir (Disoproxil Fumarate) Tenofovir (Disoproxil) ZM 306416 LY 344864 LY 344864 racemate IPSU Fexinidazole Empty

Plate layout: HY-L001P-Part A-21

1 2 3 4 5 6 7 8 9 10 11 12
a Empty SC-514 Tazemetostat PP1 PP2 UNC0646 BMS-833923 QNZ PR-619 KY02111 IU1 Empty
b Empty Stattic MK-8745 GSK2656157 SKI II C646 BPTU Atovaquone PLX647 BX517 Clevudine Empty
c Empty GW7647 PF-4989216 P 22077 Ro 31-8220 (mesylate) WHI-P154 PD168393 CNX-2006 Taselisib GANT 61 Berzosertib Empty
d Empty Flumatinib Flumatinib (mesylate) TCS 359 RGFP966 Tenofovir (hydrate) Hydroxyfasudil Hydroxyfasudil (hydrochloride) NS-398 NSC348884 PND-1186 Empty
e Empty Napabucasin PD0166285 GW0742 1-Naphthyl PP1 1-Naphthyl PP1 (hydrochloride) 1-NM-PP1 CNX-774 NVP 231 BML-277 Angiotensin II human Empty
f Empty SRPIN340 ICI 118,551 (hydrochloride) JIB-04 A 839977 Telmisartan Pioglitazone MS436 GSK1324726A SGI-1027 ZCL278 Empty
g Empty 2-Deoxy-D-glucose AMG 837 (calcium hydrate) JW 55 DDR1-IN-1 UNC0642 JSH-23 IDO-IN-7 (R)-1,2,3,4-Tetrahydro-3-isoquinolinecarboxylic acid b-AP15 CCG-1423 Empty
h Empty Ro 25-6981 (Maleate) Mps1-IN-2 Ombitasvir Dasabuvir CP 376395 BMS-378806 Rimonabant (Hydrochloride) Aclidinium (Bromide) Prucalopride Tegaserod (maleate) Empty

Plate layout: HY-L001P-Part A-22

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Zileuton MK-886 GW842166X Bexarotene B-Raf inhibitor 1 VX-11e PPQ-102 Macitentan Lixivaptan Amiodarone (hydrochloride) Empty
b Empty Clorgyline hydrochloride (S)-Rasagiline Lazabemide TGR5 Receptor Agonist Omecamtiv mecarbil Fadrozole hydrochloride Fadrozole Letrozole Bicalutamide Milrinone Empty
c Empty Olprinone (Hydrochloride) Levcromakalim Escitalopram (oxalate) Vilazodone (Hydrochloride) Vilazodone Dapivirine Lersivirine Febuxostat Lodoxamide Isavuconazole Empty
d Empty Anastrozole Entacapone Trilostane Luliconazole Nilvadipine Levosimendan Pinacidil monohydrate Vildagliptin Indacaterol (maleate) Salmeterol Empty
e Empty Tebanicline (hydrochloride) SB 271046 (Hydrochloride) Intepirdine PD153035 AC-55541 Elagolix sodium PF-04457845 PF-3845 RAD140 Emodin Empty
f Empty TBB Indomethacin Itanapraced SR3335 GSK4112 (1R,2S)-VU0155041 VU0361737 TCN238 SR1078 L-655708 Empty
g Empty 4E1RCat ICG-001 Pavinetant MP7 XMD8-92 FK 3311 Bilastine JNJ-31020028 Fatostatin A AM679 Empty
h Empty Onalespib Cetilistat UPF 1069 AF-353 YK-4-279 Methotrexate Latrepirdine (dihydrochloride) Haloperidol Clozapine Olanzapine Empty

Plate layout: HY-L001P-Part A-23

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Ziprasidone Sertindole Aripiprazole Talnetant Pimavanserin Pimavanserin tartrate Reboxetine (mesylate) TBPB GTS-21 (dihydrochloride) Donepezil Empty
b Empty E7820 PF-03814735 Palomid 529 Irosustat Lopinavir Chrysin Kaempferol Biochanin A Genistein Diethylstilbestrol Empty
c Empty Pioglitazone (hydrochloride) Tramiprosate Clioquinol Rasagiline (mesylate) (S)-Glutamic acid L-Glutamic acid monosodium salt MPEP (Hydrochloride) CPPHA [6]-Gingerol Shogaol Empty
d Empty Paradol Dexamethasone Dexamethasone (acetate) Retinoic acid DHEA Tamibarotene Sulfasalazine Diltiazem (hydrochloride) Thalidomide Dabrafenib Empty
e Empty Dabrafenib (Mesylate) Fluvastatin (sodium) Lomitapide Firocoxib CP-724714 Refametinib AZ3146 Reversine CCT241533 (hydrochloride) Resminostat (hydrochloride) Empty
f Empty Rabusertib Tepotinib NVP-BSK805 (dihydrochloride) VE-821 Anamorelin Anamorelin (hydrochloride) Choline Fenofibrate Elvitegravir Pyronaridine tetraphosphate Rolapitant Empty
g Empty Salirasib Bentamapimod Cariprazine (hydrochloride) Mirabegron Riociguat Adoprazine Elagolix (±)-Ibipinabant Olesoxime Palifosfamide Empty
h Empty Radezolid Tasimelteon Teneligliptin Teneligliptin (hydrobromide) Adarotene Sobetirome Tarafenacin (D-tartrate) Ataluren Phenylpiracetam Givinostat (hydrochloride monohydrate) Empty

Plate layout: HY-L001P-Part A-24

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Tafamidis Tedizolid (S)-Tedizolid Tedizolid (phosphate) 1-Deoxynojirimycin Lasmiditan (hydrochloride) Selexipag Tideglusib Topiroxostat Anagliptin Empty
b Empty Avibactam (sodium) Avibactam (sodium hydrate) Bedaquiline Bedaquiline (fumarate) Gemigliptin Taprenepag Arbidol (hydrochloride) Vidofludimus Bardoxolone Azilsartan Empty
c Empty Lificiguat Prinaberel Succinobucol Volinanserin Homoharringtonine Pyridine-3,4-diamine Cevipabulin Dalcetrapib Firategrast Imepitoin Empty
d Empty Ozenoxacin GSK2334470 N6022 BAY 61-3606 (dihydrochloride) AX20017 Bay 60-7550 StemRegenin 1 AST 487 Sofosbuvir Fuscoside Empty
e Empty Cligosiban Sildenafil Sildenafil (citrate) 5-Aminosalicylic Acid ATB-346 Naproxen Naproxen (sodium) Diclofenac Diclofenac (Sodium) HC-030031 Empty
f Empty Chembridge-5861528 CNQX DNQX NBQX Fanapanel Fanapanel hydrate Talampanel Dizocilpine (Maleate) (-)-Dizocilpine (Maleate) Myricetin Empty
g Empty Apoptozole Balicatib Purmorphamine Sinomenine hydrochloride Bay-K-8644 ((S)-(-)-) Bay-K-8644 ((R)-(+)-) Isotretinoin O-Phospho-L-serine Lonafarnib Doxorubicin (hydrochloride) Empty
h Empty Trichostatin A NSC 74859 XAV-939 NG 52 MLN0905 SBE13 (Hydrochloride) TAK-960 TAK-960 (dihydrochloride) Icotinib (Hydrochloride) Icotinib Empty

Plate layout: HY-L001P-Part A-25

1 2 3 4 5 6 7 8 9 10 11 12
a Empty SB1317 Dactolisib (Tosylate) Pyridostatin (hydrochloride) PF-04691502 Oglemilast Buparlisib (Hydrochloride) Nirogacestat Ipatasertib Ipatasertib dihydrochloride Filanesib Empty
b Empty ARRY-520 (R enantiomer) NVP-HSP990 GSK 650394 EMD638683 Dimethylcurcumin Avosentan TAK-285 Agerafenib Binimetinib Tonabersat Empty
c Empty Ganetespib Glibenclamide Repaglinide CHR-6494 MI-2 MI-3 PCI-34051 EPZ004777 Geldanamycin Tenofovir alafenamide Empty
d Empty Tenofovir alafenamide fumarate Tenofovir alafenamide hemifumarate Letermovir PSI-6206 ST-836 (hydrochloride) c-Kit-IN-1 NVP-LCQ195 Capromorelin (Tartrate) Alpelisib GSK2636771 Empty
e Empty TAK-580 Vistusertib GDC-0349 JZL 184 JZL195 Reparixin Reparixin (L-lysine salt) Tiplaxtinin Zosuquidar Lesinurad Empty
f Empty Lesinurad (sodium) CP-640186 (hydrochloride) BMS-911543 UNC0638 BMS-265246 AM966 Epothilone D E-64 sodium 4-pentynoate Nelfinavir (Mesylate) Empty
g Empty Ciproxifan (maleate) AIM-100 MBX-2982 S107 S107 hydrochloride CZC24832 Vonoprazan Fumarate Cabergoline Pritelivir Dynasore Empty
h Empty Eltrombopag Eltrombopag (Olamine) SLx-2119 Ivermectin Avermectin B1 WP1066 Baricitinib Baricitinib (phosphate) RI-1 Etoricoxib Empty

Plate layout: HY-L001P-Part A-26

1 2 3 4 5 6 7 8 9 10 11 12
a Empty PRT062607 (Hydrochloride) Nutlin (3b) AG 555 Hesperidin TG003 CVT-313 BAM7 Timapiprant CEP-33779 BD-AcAc 2 Empty
b Empty BIO-acetoxime ALK inhibitor 2 SB-269970 (hydrochloride) Forskolin GW 6471 Fenretinide Frentizole VU 0357121 rac-Rotigotine (Hydrochloride) Vigabatrin Empty
c Empty Teriflunomide Sacubitril Sacubitril hemicalcium salt Trelagliptin Trelagliptin (succinate) Empagliflozin MK-0557 HhAntag Vortioxetine Vortioxetine (hydrobromide) Empty
d Empty KB-R7943 (mesylate) NS309 ML-7 (hydrochloride) RS 504393 RS 127445 BML-190 5-Iodotubercidin Capivasertib CHAPS SL327 Empty
e Empty SB 415286 PF-04447943 AM251 CTEP Tezacaftor Kaempferide INCB 3284 MDA 19 Selisistat CPI-613 Empty
f Empty Roflumilast NVP-BVU972 Triciribine SAR131675 Cabazitaxel Ertugliflozin Imatinib (R)-(-)-Gossypol acetic acid (S)-Gossypol (acetic acid) CH5132799 Empty
g Empty ZM323881 (hydrochloride) IOX2 GW791343 (dihydrochloride) PRX-08066 MLN120B UK-5099 VU 0364439 YS-49 WZ811 TTP 22 Empty
h Empty D-64131 DY131 Pifithrin-α (hydrobromide) Zardaverine Salubrinal A 438079 A 438079 (hydrochloride) Scriptaid PF-670462 Picropodophyllin Empty

Plate layout: HY-L001P-Part A-27

1 2 3 4 5 6 7 8 9 10 11 12
a Empty VGX-1027 JANEX-1 Tenovin-6 Tenovin 6 (Hydrochloride) Tyrphostin A9 TC-DAPK 6 Merestinib Sotagliflozin LCL161 CGK733 Empty
b Empty ETP-46464 Emapunil kb NB 142-70 S0859 CID-2858522 Venetoclax DMAT Ebrotidine FRAX486 CP-809101 (hydrochloride) Empty
c Empty E-4031 Podofilox Mibefradil (dihydrochloride) GSK269962A AZ20 Hoechst 33258 Hoechst 33258 (trihydrochloride) Hoechst 34580 (tetrahydrochloride) AR 231453 APD668 Empty
d Empty A-317491 A-317491 (sodium salt hydrate) EI1 Piboserod GSK3787 Taltobulin Taltobulin (hydrochloride) L67 L189 GW9508 Empty
e Empty Cabotegravir Pinometostat Salinomycin SSR128129E Vesatolimod Ledipasvir Ledipasvir (acetone) Ledipasvir (D-tartrate) AZD1208 MPTP (hydrochloride) Empty
f Empty AZD-3463 GDC-0623 Maritoclax SC144 TIC10 isomer TIC10 MK-7622 Methylproamine DMA (trihydrochloride) Capsazepine Empty
g Empty FG-2216 Tyrphostin 23 UNC1999 BRD9539 GSK-J1 GSK-J2 GSK-J4 UNC1215 SGC0946 Alvelestat Empty
h Empty Sodium phenylbutyrate GW1929 Ceritinib Ceritinib dihydrochloride GSK2801 Wnt-C59 Efinaconazole Tulathromycin A IPA-3 Bivalirudin (Trifluoroacetate) Empty

Plate layout: HY-L001P-Part A-28

1 2 3 4 5 6 7 8 9 10 11 12
a Empty XMD17-109 GZD824 P005091 Idasanutlin TTNPB IDO5L SAR407899 (hydrochloride) SAR407899 Epacadostat Puromycin aminonucleoside Empty
b Empty CRT0066101 dihydrochloride PluriSln 1 Leukadherin-1 HJC0350 QNZ46 LH846 NS6180 NMS-873 Kobe0065 NU 7026 Empty
c Empty FH535 SB-222200 NSC 23766 (trihydrochloride) Afuresertib Afuresertib (hydrochloride) Rociletinib Rociletinib hydrobromide Poziotinib AGI-6780 GNF-5 Empty
d Empty Ansamitocin P-3 Birabresib Dobutamine (hydrochloride) XL228 Ellipticine (hydrochloride) CGP37157 RKI-1447 SJB2-043 3,3'-Diindolylmethane Necrostatin-1 Empty
e Empty AZD2858 Valdecoxib Erastin A 419259 (trihydrochloride) TAK-632 Ilomastat Tirabrutinib Tirabrutinib (hydrochloride) Osimertinib PF-4708671 Empty
f Empty Ribociclib Ribociclib hydrochloride Ribociclib succinate Ribociclib succinate hydrate K145 (hydrochloride) Brexpiprazole UNC2250 UNC2881 CZC-25146 WZ4003 Empty
g Empty Bromosporine Ulixertinib IWP L6 SGC-CBP30 NSC 405020 NMS-1286937 GSK 2830371 Chlorthalidone Eprosartan (mesylate) BAY 87-2243 Empty
h Empty ID-8 UNC 669 CEP-37440 SF1670 STF-083010 CPI-203 AdipoRon Flupentixol dihydrochloride CW-069 Atglistatin Empty

Plate layout: HY-L001P-Part A-29

1 2 3 4 5 6 7 8 9 10 11 12
a Empty FLI-06 HS-173 Inauhzin FTI-277 (hydrochloride) Fiboflapon Fiboflapon sodium BTB06584 LDC000067 CCT007093 TCS JNK 5a Empty
b Empty LY2119620 Mdivi-1 MG 149 PTC-209 AMG 925 (HCl) C-7280948 CK-636 DMOG LDN-212854 Y-320 Empty
c Empty Voxtalisib ABTS (diammonium salt) ADPS BBD BCA BCIP 5-BrdU CNP-AFU DAB DHBS Empty
d Empty DTNB DTE DTT HDAOS HTBA INT IPTG Luminol MTT NBT Empty
e Empty ONPG PNPG PNPP TBHBA TMB (dihydrochloride) TMB (monosulfate) TMB-PS TOOS TOPS X-GAL Empty
f Empty X-Gluc (Dicyclohexylamine) γ-GT 5(6)-FAM SE 5-FAM SE 6-FAM SE 5(6)-Carboxyfluorescein 5(6)-FITC 5-TAMRA 5(6)-TAMRA DBeQ Empty
g Empty AZD1981 ML167 CPI-169 racemate Tirasemtiv Uprosertib Entospletinib Sal003 AMD 3465 (hexahydrobromide) P7C3 P7C3-A20 Empty
h Empty H-89 (dihydrochloride) APY0201 CTX-0294885 CTX-0294885 (hydrochloride) Citarinostat Cerdulatinib Domatinostat (tosylate) Domatinostat Ricolinostat AM095 Empty

Plate layout: HY-L001P-Part A-30

1 2 3 4 5 6 7 8 9 10 11 12
a Empty AM095 (free acid) Hexaminolevulinate (hydrochloride) ARN-509 Irbinitinib AT13148 AZD3514 AZD7545 Balaglitazone BMS-303141 Cilengitide Empty
b Empty Diphenmanil (methylsulfate) ELR510444 Ethynylcytidine Gabapentin enacarbil Gadobutrol Genz-644282 JI-101 Kartogenin Kevetrin (hydrochloride) L-778123 (hydrochloride) Empty
c Empty APTO-253 LY2090314 Abemaciclib (methanesulfonate) Maribavir MDL-29951 Metipranolol hydrochloride Micafungin (sodium) Miriplatin N3PT Netupitant Empty
d Empty Nimorazole Pacritinib Glasdegib Phenformin (hydrochloride) Pipobroman RG2833 2-Bromo-1-(3,3-dinitroazetidin-1-yl)ethan-1-one Sapacitabine Tolrestat Treosulfan Empty
e Empty Ulipristal (acetate) UNBS5162 UNC-926 Pilaralisib Butein Campathecin Resveratrol Irinotecan Irinotecan (hydrochloride) 10-Deacetylbaccatin III Empty
f Empty Kanamycin (sulfate) Asenapine (hydrochloride) Irinotecan (hydrochloride trihydrate) Colchicine TCS-PIM-1-4a GW9662 Etifoxine (hydrochloride) Etifoxine LDE225 (Diphosphate) LDE225 Empty
g Empty VS-5584 PFI-1 Birinapant Brefeldin A CNX-1351 Setipiprant Folic acid ML314 LY2828360 RVX-208 Empty
h Empty EHT 1864 INH1 Skp2 Inhibitor C1 Oncrasin-1 SJ-172550 iCRT 14 HLM006474 Tyrphostin A1 Dafadine-A CFTR(inh)-172 Empty

Plate layout: HY-L001P-Part A-31

1 2 3 4 5 6 7 8 9 10 11 12
a Empty PSN632408 Mofegiline (hydrochloride) Eltoprazine (hydrochloride) RU 24969 VU 0240551 BTS AK-7 ISO-1 LDN-27219 SN 2 Empty
b Empty CID 16020046 BV6 Pifithrin-β (hydrobromide) ESI-09 BRD4770 Remodelin (hydrobromide) ZLN024 (hydrochloride) GPDA SB225002 LDN-214117 Empty
c Empty (S)-(-)-5-Fluorowillardiine (hydrochloride) 4-Azido-L-phenylalanine 4-Azido-L-phenylalanine (hydrochloride) Acumapimod Verinurad Elafibranor Emeramide Pexidartinib Solcitinib Verubecestat Empty
d Empty Fevipiprant Valbenazine Grapiprant Pexmetinib AI-10-49 ICA-121431 Rolipram (R)-(-)-Rolipram WIKI4 MC1568 Empty
e Empty NS1643 CK-869 JH-II-127 5'-Methylthioadenosine 4-Hydroxytamoxifen CC-223 Sitravatinib CC-115 CC-115 (hydrochloride) TH287 Empty
f Empty SW033291 SR9243 Fluralaner SH-4-54 TG6-10-1 Eravacycline (dihydrochloride) Darolutamide EPZ011989 SR9009 Terutroban Empty
g Empty OICR-9429 OICR-0547 Wy-14643 BD-1047 (dihydrobromide) Tolvaptan Flupirtine (Maleate) Suplatast (Tosilate) Saquinavir (Mesylate) Olmesartan Olmesartan (medoxomil) Empty
h Empty Caspofungin (Acetate) Saquinavir Toltrazuril (sulfone) Iguratimod Retapamulin Dofequidar (fumarate) Peramivir (trihydrate) Oseltamivir (phosphate) Miglustat (hydrochloride) Rifabutin Empty

Plate layout: HY-L001P-Part A-32

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Gemcitabine Epothilone B Acamprosate (calcium) Dexmedetomidine (hydrochloride) Medetomidine (hydrochloride) Doramectin Pirenzepine (dihydrochloride) Agomelatine Agomelatine (hydrochloride) Alcaftadine Empty
b Empty Darunavir Darunavir (Ethanolate) Cetirizine (dihydrochloride) Loratadine Duvelisib Duvelisib (R enantiomer) BIBR 1532 (R)-Baclofen Pramipexole (dihydrochloride) Dexpramipexole (dihydrochloride) Empty
c Empty Fenofibrate Nepafenac Loteprednol Etabonate Deferasirox Tiotropium (Bromide) Etofenamate Vancomycin (hydrochloride) Dimethyl fumarate Temozolomide Octreotide (acetate) Empty
d Empty Clozapine (N-oxide) Atazanavir (sulfate) Rivastigmine Tirofiban (hydrochloride monohydrate) Desmopressin (Acetate) Oxaliplatin Rofecoxib Posaconazole Benfotiamine Ezetimibe Empty
e Empty Dabigatran (ethyl ester) Atorvastatin (hemicalcium salt) (S)-Timolol (Maleate) Idarubicin (hydrochloride) Metoclopramide Metoclopramide (hydrochloride hydrate) Valspodar Atomoxetine (hydrochloride) Rosiglitazone (-)-Huperzine A Empty
f Empty (±)-Huperzine A Genipin Loxapine Loxapine (succinate) Pamabrom Zalcitabine Terbinafine Butenafine (Hydrochloride) Mitiglinide (Calcium) Racecadotril Empty
g Empty Tegafur Ranolazine (dihydrochloride) Manidipine (dihydrochloride) Cilnidipine Alarelin (Acetate) Tolcapone Ziprasidone (hydrochloride monohydrate) Mevastatin Nystatin Iloperidone Empty
h Empty Limonin Zidovudine Guanfacine (hydrochloride) Vinblastine Acyclovir Abacavir Abacavir (sulfate) Penciclovir Valacyclovir (hydrochloride) Famciclovir Empty

Plate layout: HY-L001P-Part A-33

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Emtricitabine Tripelennamine (hydrochloride) Flecainide (acetate) Amprenavir Boldenone Undecylenate 4'-Demethylepipodophyllotoxin Clevidipine Mefloquine (hydrochloride) Cidofovir Salinomycin (sodium salt) Empty
b Empty Rocuronium (Bromide) Azathramycin Sivelestat Sivelestat (sodium tetrahydrate) Fosbretabulin (disodium) Cefditoren (Pivoxil) Salmeterol (xinafoate) Pramiracetam Noopept Clopidogrel (hydrogen sulfate) Empty
c Empty Garenoxacin (Mesylate hydrate) Cortisone Cortisone (acetate) Prednisolone Cilostazol Glycopyrrolate Bumetanide Gimeracil Mizoribine Metformin (hydrochloride) Empty
d Empty Embelin Parecoxib Parecoxib (Sodium) Nifenazone Carbasalate calcium Guacetisal Amfenac Sodium Hydrate Ampiroxicam Oxaceprol Zafirlukast Empty
e Empty MI-773 Carteolol (hydrochloride) Acebutolol (hydrochloride) Atenolol Bambuterol (hydrochloride) Simvastatin Metoprolol (Succinate) Rosuvastatin (Calcium) Candesartan (Cilexetil) Azithromycin Empty
f Empty Pantoprazole (sodium) Clarithromycin Deracoxib Gossypol (acetic acid) Potassium oxonate Losartan Losartan (potassium) Itraconazole Tolfenpyrad Valifenalate Empty
g Empty Novaluron Penthiopyrad Cyhalofop Aldicarb (sulfone) APY29 ZLN005 ML-323 LGK974 Sunifiram NMDA Empty
h Empty sn-Glycero-3-phosphocholine Coluracetam (R)-Oxiracetam Meclofenoxate (hydrochloride) Demeclocycline (hydrochloride) G-418 (disulfate) 2'-Deoxyguanosine 2'-Deoxycytidine (hydrochloride) Bleomycin (sulfate) Capreomycin (sulfate) Empty

Plate layout: HY-L001P-Part A-34

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Nonivamide Difluprednate Desoximetasone Oxytocin (acetate) Carbetocin Thio-TEPA Melphalan Berberine (chloride hydrate) Fidaxomicin Buparvaquone Empty
b Empty Griseofulvin 4-Methylbenzylidene camphor Chloroquine (diphosphate) Radafaxine (hydrochloride) Bithionol Oxyclozanide Mebendazole Closantel Rafoxanide Acalabrutinib Empty
c Empty Belizatinib Bexagliflozin Cenerimod Daprodustat Ezutromid Nastorazepide Framycetin Avacopan NKP608 PS-1145 Empty
d Empty LFM-A13 Spebrutinib CEP-28122 (mesylate salt) BVT 2733 BVT-14225 PF-915275 Pyrimethamine GSK2606414 AGI-5198 Quercetin Empty
e Empty TCS PIM-1 1 CX-6258 CX-6258 (hydrochloride hydrate) PRE-084 (hydrochloride) BD1063 (dhydrochloride) CCT241736 GNE-7915 GNE-7915 (tosylate) AZD2932 Valsartan Empty
f Empty LCZ696 Omapatrilat Leupeptin (hemisulfate) Avanafil Udenafil ARN2966 Purvalanol B Purvalanol A Filgotinib BMS-3 Empty
g Empty BMS-5 GW 441756 GlyH-101 IOWH-032 L-Thyroxine L-Thyroxine (sodium salt pentahydrate) Diflunisal Mozavaptan Conivaptan (hydrochloride) TMP269 Empty
h Empty TMP195 RU-SKI 43 (hydrochloride) Bioymifi 4-Phenoxybenzylamine 3-Indoleacetic acid 6-O-α-Maltosyl-β-cyclodextrin Azimilide (Dihydrochloride) FIIN-2 PD158780 Diclofensine (hydrochloride) Empty

Plate layout: HY-L001P-Part A-35

1 2 3 4 5 6 7 8 9 10 11 12
a Empty RS102895 (hydrochloride) YL-109 PFI-2 (hydrochloride) UMI-77 SU9516 Ro 48-8071 (fumarate) GSK2879552 Apoptosis Activator 2 NSC319726 LDN-57444 Empty
b Empty Nodinitib-1 TZ9 CWHM-12 Ro 5126766 TEPP-46 RQ-00203078 PFI-4 GSK-5959 Bremelanotide (Acetate) PU-WS13 Empty
c Empty Voxelotor Centrinone Centrinone-B CPDA N6-[2-(4-Aminophenyl)ethyl]adenosine SYM2206 Enasidenib Enasidenib (mesylate) AMG-337 JD-5037 Empty
d Empty L-701324 CIQ BRD73954 Targocil Azoramide Tranilast (trans-) K-Ras(G12C) inhibitor 12 Erdafitinib SCR-1481B1 BG45 Empty
e Empty BRD7116 Ornidazole (Levo-) Endoxifen (hydrochloride) GlyT2-IN-1 STF-31 L-NAME (hydrochloride) 1400W (Dihydrochloride) L-NMMA acetate Lipoic acid Pyrrolidinedithiocarbamate (ammonium) Empty
f Empty VR23 BQR-695 SC79 AZD3759 6-Thio-2'-Deoxyguanosine Ivosidenib (R,S)-Ivosidenib NCT-501 O4I1 O4I2 Empty
g Empty N6-(4-Hydroxybenzyl)adenosine KC7F2 BBT594 CBL0137 hydrochloride Alda-1 WEHI-345 Selonsertib N6-Cyclohexyladenosine LY354740 ONO-4059 (analog) Empty
h Empty NMS-P118 BI-847325 CCT245737 CHZ868 AMI-1 TAS-301 PF-04418948 Aldose reductase-IN-1 PLX8394 Dp44mT Empty

Plate layout: HY-L001P-Part A-36

1 2 3 4 5 6 7 8 9 10 11 12
a Empty I-BRD9 UF010 KML29 GR79236 Decursin Anisomycin SAR405838 ETC-159 GSK180736A Adjudin Empty
b Empty LMK-235 Sulfaclozine 3-Methyladenine LLY-507 NU2058 ITE MI-136 Orexin 2 Receptor Agonist AZD6738 ACY-738 Empty
c Empty HA130 DASA-58 WZB117 L755507 TMS Compound 401 Lifitegrast WDR5-0103 Pimelic Diphenylamide 106 BML-210 Empty
d Empty MN-64 T56-LIMKi FPS-ZM1 Lorediplon Didox Pyr10 Hemin Pimelic Diphenylamide 106 (analog) trans-ACPD Maytansinol Empty
e Empty Ribocil-C GSK2018682 Seladelpar sodium salt ZM241385 SCH 58261 NI-57 GSK864 Brusatol SCH 23390 (hydrochloride) BEC (hydrochloride) Empty
f Empty JNJ-46778212 PF-06260933 NQDI-1 Peficitinib GSK1016790A MS023 NVP-ACC789 MCB-613 JNJ-42165279 SW044248 Empty
g Empty GSK2256294A Pumosetrag Hydrochloride Cariporide BRD7552 (-)-p-Bromotetramisole (oxalate) Tauroursodeoxycholate (Sodium) trans-Zeatin 4μ8C LJH685 LJI308 Empty
h Empty XY1 SGC707 A-1155463 NSC59984 Olmutinib SID 3712249 BIBS 39 lumateperone (Tosylate) NK-252 KJ Pyr 9 Empty

Plate layout: HY-L001P-Part A-37

1 2 3 4 5 6 7 8 9 10 11 12
a Empty TY-52156 DG172 (dihydrochloride) JW74 A-1331852 BMS-202 N-deacetylated BMS-202 HPOB PD 151746 DprE1-IN-1 VU0357017 (hydrochloride) Empty
b Empty KS176 OTX008 RS-1 ML240 ML241 (hydrochloride) ML-098 STO-609 Indirubin-3'-monoxime C-DIM12 EGFR-IN-3 Empty
c Empty Avitinib (maleate) PRT4165 NAN-190 (hydrobromide) NSC117079 3PO 4EGI-1 SC66 Fenebrutinib PF06650833 JNJ-63533054 Empty
d Empty COTI-2 ASP-9521 Adomeglivant Fruquintinib BMS-779788 Vactosertib Vactosertib (Hydrochloride) Dimethylenastron Leucomethylene blue (Mesylate) Pleconaril Empty
e Empty CH5183284 XEN907 Mirin BCTC K858 (Racemic) YM-90709 KM11060 ML239 RN-1734 YU238259 Empty
f Empty RCM-1 PRIMA-1Met PRIMA-1 PF-06459988 BML-284 MK-571 (sodium salt) BMS-1 3-Bromopyruvic acid ML264 GSK137647A Empty
g Empty 4-(2-(5-(3,5-Dimethylisoxazol-4-yl)-2-(4-propoxyphenethyl)-1H-benzo[d]imidazol-1-yl)ethyl)morpholine hydrochloride L-165041 Pictilisib (dimethanesulfonate) CRAC intermediate 2 Tyrphostin AG 879 PD-168077 maleate Methyl linolenate BCI-121 Glycolic acid oxidase inhibitor 1 Salsolidine Empty
h Empty Methoxsalen Xanthotoxol (S)-Leucic acid (S)-2-Hydroxy-3-phenylpropanoic acid Clemizole (hydrochloride) Benzydamine (hydrochloride) Roscovitine T863 Setiptiline Setiptiline (maleate) Empty

Plate layout: HY-L001P-Part A-38

1 2 3 4 5 6 7 8 9 10 11 12
a Empty 3-arylisoquinolinamine derivative Telcagepant Pelitinib Neratinib Triptonide GSK-4716 Ethylmalonic acid L-Hydroxyproline Tofacitinib Tofacitinib (citrate) Empty
b Empty 2,3-Dimethoxybenzaldehyde Octanoic acid 5-Amino-3H-imidazole-4-Carboxamide (-)-Aspartic acid Dopamine serotonin antagonist-1 E3 ligase Ligand 1 (dihydrochloride) Transcrocetin meglumine salt Nucleozin CCR2-RA-[R] Pictilisib Empty
c Empty Mavorixafor (hydrochloride) GW 4064 Glucagon receptor antagonists-2 Glucagon receptor antagonists-3 Laropiprant Etomoxir (R)-(+)-Etomoxir (sodium salt) HOKU-81 CI-1040 AT9283 Empty
d Empty A-769662 Apixaban DGAT-1 inhibitor 2 Zosuquidar (trihydrochloride) GRA Ex-25 Azeliragon JNJ-38877605 Tivantinib GW-1100 Senicapoc Empty
e Empty Nutlin (3) A-740003 BI 2536 Selumetinib A939572 KU-0063794 Calcium-Sensing Receptor Antagonists I MK591 Asparagusic acid Linifanib Empty
f Empty LY-411575 Ispinesib Palbociclib (hydrochloride) Ibutamoren (Mesylate) Avagacestat ZSTK474 Silmitasertib Silmitasertib (sodium salt) Ruxolitinib Ruxolitinib (phosphate) Empty
g Empty GDC-0879 Bafetinib FK866 GSK461364 Crizotinib Crizotinib (hydrochloride) Elacridar BMS 299897 gamma-secretase modulator 3 Gefitinib Empty
h Empty Gefitinib (hydrochloride) Erlotinib Lapatinib Lapatinib (ditosylate) ONO-AE3-208 Rivaroxaban Nintedanib Dovitinib LY404039 ABT-737 Empty

Plate layout: HY-L001P-Part A-39

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Perifosine Temsirolimus WAY-362450 Plerixafor (octahydrochloride) CI-994 Troglitazone AT7519 AT7519 (Hydrochloride) Imatinib (Mesylate) PLX-4720 Empty
b Empty Tolimidone SC-560 2-Amino-1-phenylethanol Epalrestat Cinepazide (Maleate) Proparacaine (Hydrochloride) FITC 6-FITC 6-FAM 5-FAM Empty
c Empty 3-Methylpyrazole Enzalutamide N-desmethyl Enzalutamide Carboxypeptidase G2 (CPG2) Inhibitor CPA inhibitor TOK-001 Abiraterone Cevimeline (hydrochloride) Otamixaban Cinacalcet Empty
d Empty Cinacalcet (hydrochloride) GSK-1070916 Alosetron (Hydrochloride) Safinamide Aurora A inhibitor I Buparlisib SB-408124 GSK256066 (2,2,2-trifluoroacetic acid) D609 Zaurategrast Empty
e Empty CCG-63808 SPK-601 Calcipotriol Impurity C Abiraterone (acetate) Methyl vanillate Rotigotine VX-222 Dronedarone (Hydrochloride) M2 ion channel blocker L-Pyroglutamic acid Empty
f Empty Voriconazole Dexrazoxane (Hydrochloride) 5-Hydroxypyrazine-2-Carboxylic Acid Monoammonium glycyrrhizinate hydrate Etodolac Faropenem sodium I2906 Galanthamine Vitamin D2 (R)-5-Hydroxymethyl Tolterodine Empty
g Empty SB-408124 (Hydrochloride) NBD-556 Alvimopan (monohydrate) Alvimopan (dihydrate) Cevimeline (hydrochloride hemihydrate) Chenodeoxycholic Acid 5-R-Rivaroxaban Furagin Poloxime 9-Dihydro-13-acetylbaccatin III Empty
h Empty Dabigatran (ethyl ester hydrochloride) Cephalomannine Cysteamine (Hydrochloride) Ibuprofen (R)-(-)-Ibuprofen MNS A 77-01 JQ-1 (carboxylic acid) (S)-Dolaphenine (hydrochloride) FAAH-IN-2 Empty

Plate layout: HY-L001P-Part A-40

1 2 3 4 5 6 7 8 9 10 11 12
a Empty MRE-269 THZ1 THZ1 (Hydrochloride) Ritonavir Etravirine 5-Fluorouracil Nortadalafil Tadalafil Solifenacin (Succinate) Lenalidomide Empty
b Empty Lenalidomide (hemihydrate) Decitabine Clofarabine Pentostatin Rotigotine (Hydrochloride) B-HT 920 Galanthamine (hydrobromide) Darifenacin (hydrobromide) Bosentan Bosentan (hydrate) Empty
c Empty Ramelteon Bepotastine (Beslilate) Dronedarone Paliperidone Palonosetron (Hydrochloride) Azaphen (dihydrochloride monohydrate) Alogliptin (Benzoate) Fenspiride (Hydrochloride) Valganciclovir (hydrochloride) Solifenacin Empty
d Empty Bazedoxifene (acetate) Lasofoxifene (Tartrate) Rufinamide Cilazapril (monohydrate) Gabapentin Gabapentin (hydrochloride) Nifuratel Malotilate Trifluorothymidine Telithromycin Empty
e Empty Tipiracil (hydrochloride) Verapamil (hydrochloride) Palbociclib (isethionate) Tolazoline (hydrochloride) Oxybenzone Aurothioglucose Doxylamine (succinate) 3,3',5-Triiodo-L-thyronine (sodium) 3,3',5-Triiodo-L-thyronine Decloxizine (dihydrochloride) Empty
f Empty Tebipenem Perphenazine Tetracaine Aminohippurate (sodium) Fluphenazine (dihydrochloride) Diphenidol (hydrochloride) Methacholine (chloride) Procainamide (hydrochloride) Netilmicin (sulfate) Octocrylene Empty
g Empty Cefotaxime (sodium salt) Colistin (sulfate) Nitrofurantoin Pargyline (hydrochloride) Trimethadione Mexiletine (hydrochloride) Flibanserin Thiamine monochloride Nitroprusside (disodium dihydrate) Sapropterin (dihydrochloride) Empty
h Empty Alizapride hydrochloride Etofibrate Histamine (phosphate) Sulfalene N-Acetyl-D-glucosamine Dapiprazole (hydrochloride) Phenprocoumon Diflorasone Zuclopenthixol Cilastatin Empty

Plate layout: HY-L001P-Part A-41

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Regadenoson Adenosine monophosphate Adenosine 5'-monophosphate monohydrate Felypressin Cerulenin Flucloxacillin sodium Pentagastrin Propyphenazone Amezinium (methylsulfate) Cyproconazole Empty
b Empty Hexaconazole Benzenebutyric acid Pyrvinium pamoate Gemcitabine (Hydrochloride) Doxofylline Toremifene (Citrate) Carvedilol Sulindac Flumazenil Docetaxel Empty
c Empty Pamidronic acid Paclitaxel Capecitabine Telbivudine Tropisetron (Hydrochloride) Doxifluridine Flutamide Azelnidipine Prulifloxacin Voglibose Empty
d Empty Valnemulin (Hydrochloride) Fludarabine (phosphate) D-Cycloserine Quetiapine (fumarate) Vigabatrin (Hydrochloride) Donepezil (Hydrochloride) Sulfamethazine Azasetron (hydrochloride) Fludarabine Granisetron (Hydrochloride) Empty
e Empty Tropisetron Melatonin (±)-Bisoprolol (hemifumarate) Bendamustine (hydrochloride) Dacarbazine Sugammadex (sodium) Leflunomide Dienogest Acarbose Adapalene Empty
f Empty Benazepril (hydrochloride) Artemisinin Floxuridine Doxazosin (mesylate) Edaravone Etomidate Etomidate (hydrochloride) Fluconazole Fluoxetine (hydrochloride) Fluvoxamine (maleate) Empty
g Empty Glimepiride Ketoconazole (+)-Ketoconazole (-)-Ketoconazole Levetiracetam Acitretin Daptomycin Dorzolamide (hydrochloride) Gestodene Drospirenone Empty
h Empty Minoxidil Omeprazole Oxcarbazepine Pizotifen Stavudine Tigecycline Vecuronium (bromide) Risedronate (sodium) Topiramate Zonisamide Empty

Plate layout: HY-L001P-Part A-42

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Ofloxacin Marbofloxacin Diphylline Aztreonam Perindopril (erbumine) Norfloxacin Natamycin Bestatin Furosemide Cefdinir Empty
b Empty Prilocaine Ketorolac (tromethamine salt) Flucytosine Aminophylline Estradiol Alpha-Estradiol Niacin Pitavastatin (Calcium) Verteporfin Pefloxacin (mesylate) Empty
c Empty Tranexamic acid Nicotinamide Pregnenolone Adenine Ticlopidine (hydrochloride) Fluticasone (propionate) Ketotifen (fumarate) Cytidine Balofloxacin Lafutidine Empty
d Empty Duloxetine (hydrochloride) Ivabradine (hydrochloride) Detomidine (hydrochloride) Pravastatin (sodium) L-Ascorbic acid L-Ascorbic acid sodium salt Salicylic acid Sodium Salicylate Milnacipran (hydrochloride) Milnacipran ((1S-cis) hydrochloride) Empty
e Empty Azatadine (dimaleate) Antipyrine Lithocholic acid Olsalazine (Disodium) Toltrazuril Sertraline (hydrochloride) Tinidazole Guanidine (hydrochloride) Imiquimod Altretamine Empty
f Empty Carmofur Felbamate Lidocaine Lidocaine (hydrochloride) Cefoselis (sulfate) Doripenem (monohydrate) Mianserin (hydrochloride) Mosapride (citrate) Nafamostat (mesylate) Alfuzosin Empty
g Empty Prazosin (hydrochloride) Tizanidine (hydrochloride) Tranilast Venlafaxine (hydrochloride) Naratriptan (hydrochloride) Cefaclor Mycophenolate Mofetil Cephalexin Cephalexin (monohydrate) Irbesartan Empty
h Empty Nebivolol (hydrochloride) Pimobendan Candesartan Pyridostigmine (bromide) Methimazole Metolazone Cefoperazone Riluzole Riluzole hydrochloride Sulfameter Empty

Plate layout: HY-L001P-Part A-43

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Prednisone Acetylcysteine Ethynyl Estradiol Nitazoxanide Orlistat Allopurinol Erythromycin Amphotericin B 1-Docosanol Albendazole Empty
b Empty Chlorothiazide L-(-)-α-Methyldopa (hydrate) Nitrofurazone Ketoprofen Adenosine Phenylbutazone Enalaprilat (dihydrate) Dofetilide Isradipine Estrone Empty
c Empty Trichlormethiazide Amorolfine (hydrochloride) Disulfiram Ipratropium (bromide) Sulfanilamide Praziquantel Busulfan Carbamazepine Torsemide Desonide Empty
d Empty Didanosine Lamivudine Eplerenone Piroxicam Glipizide Adefovir dipivoxil Azathioprine Gemfibrozil Indapamide Methylprednisolone Empty
e Empty Meloxicam Methocarbamol Thiabendazole Guaifenesin Nimodipine Gadodiamide (hydrate) Oxybutynin Oxybutynin (chloride) Enoxacin (hydrate) Rifapentine Empty
f Empty Suprofen Pyrazinamide Rifampicin Sulfadiazine Chlorprothixene Oxytetracycline Ethionamide Vidarabine Ramipril Ranitidine (hydrochloride) Empty
g Empty Acetylcholine (chloride) Acipimox Nifedipine Amiloride (hydrochloride) Amiloride hydrochloride dihydrate Chlorpheniramine (maleate) Clofibrate Fenoprofen (Calcium hydrate) Erdosteine Pranlukast Empty
h Empty Pranlukast (hemihydrate) Oxfendazole Atracurium (besylate) Butoconazole (nitrate) Flubendazole Chloroxine Clemastine (fumarate) Oxibendazole (2S)-2-Amino-3-methyl-3-sulfanylbutanoic acid Bifonazole Empty

Plate layout: HY-L001P-Part A-44

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Etidronic acid Diphenhydramine (hydrochloride) Dapoxetine (hydrochloride) Roxatidine (Acetate Hydrochloride) Prothionamide Idoxuridine Sparfloxacin Felodipine Nizatidine Carbidopa Empty
b Empty Dipyridamole Hydroxyurea Vitamin B12 Avobenzone Amlodipine Amlodipine (maleate) Amlodipine (besylate) Metronidazole Tioconazole Cromolyn (sodium) Empty
c Empty Tropicamide Sulfamethoxazole Sulfisoxazole Phenindione Alibendol Irsogladine Triamcinolone Isoniazid Levofloxacin Levofloxacin (hydrate) Empty
d Empty Enalapril (maleate) Menadione Sulfamethizole Sulbactam Tolfenamic Acid Pranoprofen Sulfadimethoxine Rimantadine (hydrochloride) Primidone Nefiracetam Empty
e Empty Nicorandil Meglumine Sarafloxacin (hydrochloride) Methscopolamine (bromide) ATP (disodium salt) Propylthiouracil Lacidipine Meclizine (dihydrochloride) Sodium Butyrate Taurine Empty
f Empty Mirtazapine Chlormezanone Ginkgolide A Diclazuril Flunarizine (dihydrochloride) Fenticonazole (Nitrate) Rebamipide Aspartame Phentolamine (mesylate) Nimesulide Empty
g Empty Dyclonine (hydrochloride) Memantine (hydrochloride) Cyproheptadine (hydrochloride) Lornoxicam Captopril Orphenadrine (citrate) Tolnaftate Terazosin (hydrochloride dihydrate) Bromhexine (hydrochloride) Tiopronin Empty
h Empty Moxonidine Argatroban (monohydrate) Mecarbinate Famotidine Moexipril (hydrochloride) Adiphenine (hydrochloride) Trimebutine (maleate) Betaxolol Betaxolol (hydrochloride) Levobetaxolol (hydrochloride) Empty

Plate layout: HY-L001P-Part A-45

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Fosinopril (sodium) Temocapril (hydrochloride) Gabexate (mesylate) Flunixin (meglumine) Ibutilide (fumarate) Probucol Dextrose Mestranol Naftopidil (S)-(+)-Rolipram Empty
b Empty Fudosteine Atropine (sulfate monohydrate) Sitafloxacin (hydrate) Tebipenem pivoxil Dichlorphenamide Nalidixic acid D-Sorbitol Tolbutamide Amantadine (hydrochloride) Benserazide (hydrochloride) Empty
c Empty Bethanechol (chloride) Clindamycin (hydrochloride) Clonidine (hydrochloride) Domperidone Estriol Fenbendazole Fluocinolone (Acetonide) Gallamine Triethiodide Loperamide (hydrochloride) Moroxydine (hydrochloride) Empty
d Empty Mycophenolic acid Nateglinide Neostigmine (Bromide) Nitrendipine Novobiocin (Sodium) Olopatadine (hydrochloride) Ozagrel Ozagrel (sodium) Pancuronium (dibromide) D-Pantothenic acid (sodium) Empty
e Empty Phenoxybenzamine (hydrochloride) Propafenone (hydrochloride) Quinine (hydrochloride dihydrate) Ribavirin Roxithromycin Salbutamol (hemisulfate) Sotalol (hydrochloride) Spectinomycin (dihydrochloride) Sulfadoxine Tenoxicam Empty
f Empty Tobramycin Vardenafil (hydrochloride) Xylazine (hydrochloride) Maprotiline (hydrochloride) NAD+ Naphazoline (hydrochloride) L-Epinephrine (Bitartrate) Phenytoin Phenytoin (sodium) Methacycline (hydrochloride) Empty
g Empty Ciclopirox Ciclopirox (olamine) Dopamine (hydrochloride) Econazole (nitrate) Miconazole (nitrate) Lomefloxacin (hydrochloride) Clomipramine (hydrochloride) Cefprozil (monohydrate) Scopine (hydrochloride) Trospium (chloride) Empty
h Empty Azelastine (hydrochloride) Clomiphene (citrate) Hydralazine (hydrochloride) Oxacillin (sodium monohydrate) Cloxacillin (sodium monohydrate) Amoxicillin (sodium) Amoxicillin Amoxicillin (trihydrate) Medroxyprogesterone (acetate) Neomycin (sulfate) Empty

Plate layout: HY-L001P-Part A-46

1 2 3 4 5 6 7 8 9 10 11 12
a Empty (R)-(-)-Phenylephrine (hydrochloride) Streptomycin (sulfate) Tetracycline (hydrochloride) Xylometazoline (hydrochloride) Phenacetin Quinapril (hydrochloride) Trazodone (hydrochloride) Thiamphenicol Brompheniramine (maleate) Miglitol Empty
b Empty Acemetacin Tioxolone Buflomedil (hydrochloride) Fluocinonide Lonidamine Clorsulon Arecoline (hydrobromide) Hygromycin B Carbazochrome (sodium sulfonate) Paroxetine (hydrochloride) Empty
c Empty Niflumic acid Bufexamac Lamotrigine PMSF Niclosamide Bindarit Otilonium (bromide) Alverine (citrate) Danofloxacin (mesylate) Enrofloxacin Empty
d Empty 2-Thiouracil Creatinine Moguisteine Nadifloxacin Sulfathiazole (sodium) Ornidazole Amikacin (sulfate) Trimethoprim Biotin Sulfamerazine Empty
e Empty Methylthiouracil Ibandronate (Sodium Monohydrate) Articaine (hydrochloride) Mepivacaine (hydrochloride) Naftifine (hydrochloride) Tylosin (tartrate) Tylosin Benztropine (mesylate) Altrenogest Ampicillin (sodium) Empty
f Empty Anagrelide (hydrochloride) Betahistine (dihydrochloride) Flumequine Amitriptyline (hydrochloride) Octopamine (hydrochloride) Azlocillin (sodium salt) Azacyclonol Triflusal Trifluoperazine (dihydrochloride) Moclobemide Empty
g Empty Ethambutol (dihydrochloride) Pentamidine (isethionate) Pemirolast (potassium) Desloratadine Cyclamic acid Ouabain (Octahydrate) Allylthiourea Sodium Picosulfate Probenecid Homatropine (Bromide) Empty
h Empty Hydroxyzine (dihydrochloride) Flavoxate (hydrochloride) Doxapram (hydrochloride hydrate) Dibucaine Dibucaine (hydrochloride) Methazolamide Nafcillin (sodium monohydrate) Tetrahydrozoline (hydrochloride) Bisacodyl Carbimazole Empty

Plate layout: HY-L001P-Part A-47

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Nabumetone Spironolactone Ropivacaine (hydrochloride monohydrate) Ropivacaine hydrochloride Ronidazole Guanabenz (Acetate) Dequalinium (Chloride) Deferiprone Hexamethonium (Bromide) Decamethonium (Bromide) Empty
b Empty Zinc Pyrithione Propranolol (hydrochloride) Mefenamic acid Triamterene Sulfacetamide (Sodium) Latanoprost Loxoprofen Cyclosporin A Piracetam Methylcobalamin Empty
c Empty Brinzolamide Tetrabenazine Tetrabenazine (Racemate) Tetrabenazine ((+)-) Trandolapril Ceftazidime Iohexol Ramosetron (Hydrochloride) Taltirelin Fondaparinux (sodium) Empty
d Empty Desvenlafaxine Desvenlafaxine (succinate hydrate) 4-Aminopyridine Diquafosol (tetrasodium) Nitisinone Chlorhexidine (digluconate) Misoprostol Lercanidipine (hydrochloride) Mafenide (Acetate) Cefepime (Dihydrochloride Monohydrate) Empty
e Empty Ademetionine Zaltoprofen Triclabendazole Ropinirole (hydrochloride) Ciclesonide Aceclofenac Triamcinolone (acetonide) Bezafibrate Amifostine Epinastine Empty
f Empty Felbinac Isosorbide mononitrate Dirithromycin Sucralfate Prednisolone (disodium phosphate) Butylphthalide Levobupivacaine (hydrochloride) Rabeprazole (sodium) Brimonidine Brimonidine (tartrate) Empty
g Empty Eicosapentaenoic Acid Imidafenacin Ciprofibrate Balsalazide Dihydroergotamine (mesylate) β-Estradiol 17-valerate Pirfenidone Ebastine Metaxalone Iopamidol Empty
h Empty Eptifibatide Warfarin Dapsone Indinavir (sulfate) Tiagabine (hydrochloride) Ceftibuten (dihydrate) Nicergoline Eslicarbazepine (acetate) Azelaic acid β-Estradiol 17-acetate Empty

Plate layout: HY-L001P-Part A-48

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Carglumic Acid Ceftriaxone (sodium salt) Amlexanox Pentoxifylline Tocofersolan Ospemifene Pazufloxacin (mesylate) Doxepin (Hydrochloride) Pamidronate (disodium pentahydrate) Itopride (hydrochloride) Empty
b Empty Fenoldopam (mesylate) Sertaconazole (nitrate) Dithranol Citicoline Citicoline sodium salt Cyclobenzaprine (hydrochloride) Hydroxyprogesterone caproate Eflornithine (hydrochloride, hydrate) Ramatroban Eicosapentaenoic acid (ethyl ester) Empty
c Empty Dolasetron Dolasetron (Mesylate hydrate) Gliclazide Hematoporphyrin Hematoporphyrin (dihydrochloride) Troxipide Fenofibric acid Ibudilast Bucladesine (sodium salt) Bucladesine (calcium salt) Empty
d Empty Bicyclol Lomerizine dihydrochloride Artemotil Cefozopran (hydrochloride) Seratrodast Moxidectin Milbemycin oxime Teprenone Fimasartan Acetazolamide Empty
e Empty Gadodiamide LY2409881 SU6656 Altiratinib CZC-54252 AZ-5104 MHY1485 Gastrodenol Etretinate Dihydroergotoxine (mesylate) Empty
f Empty Guanethidine (sulfate) Fexofenadine (hydrochloride) Terbutaline (sulfate) Proguanil Oxaprozin Theophylline Pivmecillinam (hydrochloride) Pymetrozine Spirodiclofen Dinotefuran Empty
g Empty Imidacloprid Tebuconazole Cefmenoxime (hydrochloride) Fomepizole Halcinonide Halobetasol (propionate) Acetohexamide Edrophonium (chloride) Proflavine (hemisulfate) Minaprine Empty
h Empty Iproniazid (phosphate) Permethrin Ethacridine (lactate monohydrate) Zomepirac (sodium salt) Benzyl alcohol Triacetin Bisoctrizole Ceftiofur (sodium) Anethole Hexylene glycol Empty

Plate layout: HY-L001P-Part A-49

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Tilmicosin (phosphate) Bucetin Resorcinol Meticrane Triflupromazine (hydrochloride) Pyrithioxin (dihydrochloride) Chlorophyllin (sodium copper salt) 10-Undecenoic acid 10-Undecenoic acid (zinc salt) Orbifloxacin Empty
b Empty Propoxur Chlorindione Azaserine Tolazamide Succinylsulfathiazole Danthron Anisindione Diatrizoic acid Sodium diatrizoate Octisalate Empty
c Empty Citiolone Levocarnitine propionate (hydrochloride) Ethylparaben Benzyl benzoate Roxarsone Amprolium (hydrochloride) Ethylvanillin 6-Benzylaminopurine Benzethonium chloride Malathion Empty
d Empty Pidotimod Nitromide Sulfamonomethoxine Sulfanitran Protriptyline (hydrochloride) 2-Aminoheptane Oxethazaine Paromomycin (sulfate) Erythromycin Ethylsuccinate Mupirocin Empty
e Empty Chloramine-T Sulfabenzamide Piperidolate (hydrochloride) Piperidolate Cloxiquine Thioridazine (hydrochloride) Dioxybenzone Phthalylsulfacetamide Trimetazidine (dihydrochloride) Cresol Empty
f Empty Diphenylpyraline (hydrochloride) Pheniramine (Maleate) Cinchophen Dibenzothiophene Methicillin (sodium salt) Dicloxacillin (Sodium hydrate) DEET Lobeline (hydrochloride) Pindolol Fendiline (hydrochloride) Empty
g Empty Phenazopyridine (hydrochloride) Hexylresorcinol Ascorbyl palmitate Deferoxamine (mesylate) Carzenide Thiostrepton Amoxapine Nithiamide Mangafodipir (trisodium) Cyanoacetohydrazide Empty
h Empty Hexetidine Hydroquinidine Dehydrocholate (sodium) Selenomethionine L-SelenoMethionine Dinitolmide 8-Hydroxyquinoline 4-Aminobenzoic acid Ethylenediaminetetraacetic acid (trisodium salt) Edoxudine Empty

Plate layout: HY-L001P-Part A-50

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Quinestrol Trapidil Molindone (hydrochloride) Phenelzine (sulfate) Sulpiride Chloralose Vincamine Dimesna Mexenone DL-Panthenol Empty
b Empty Digoxigenin Adelmidrol Pantethine Danazol Lanatoside C Dropropizine Metergoline Levobunolol (hydrochloride) L-Cysteine methyl ester (hydrochloride) Ambroxol Empty
c Empty Ftaxilide Aminoguanidine (hydrochloride) Oxolamine (citrate) Piromidic acid Idramantone Chlorazanil Clofazimine Carsalam Pasiniazid Digoxin Empty
d Empty Gemifloxacin (mesylate) Flumethasone Iotalamic acid Carbetapentane (citrate) Procodazole Nefopam (hydrochloride) Levosulpiride 6α-Methylprednisolone 21-hemisuccinate (sodium salt) Nicotinic acid N-oxide Dexchlorpheniramine (maleate) Empty
e Empty Terpin (hydrate) Aceglutamide Butylhydroxyanisole Antazoline (hydrochloride) Molsidomine Lasalocid Ethamsylate Fosfomycin (calcium) Penfluridol Cefazolin (sodium) Empty
f Empty Suxibuzone Tilorone (dihydrochloride) Oxidopamine (hydrobromide) Antimonyl (potassium tartrate trihydrate) Modaline (sulfate) Cinoxacin N-Acetyl-DL-phenylalanine Ethynodiol (diacetate) Cinnarizine Gluconate (Calcium) Empty
g Empty Gluconate (sodium) Chlormadinone (acetate) Etamivan Hycanthone Estradiol (cypionate) Evans Blue Indoprofen Tetrahydroxyquinone Naftidrofuryl (oxalate) Labetalol (hydrochloride) Empty
h Empty N-Acetylprocainamide Nomifensine Nomifensine (maleate) Amitraz Fluorothyl Buspirone (hydrochloride) Cefoxitin (sodium) Secnidazole Triclosan Temephos Empty

Plate layout: HY-L001P-Part A-51

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Flunisolide L-Cycloserine Auranofin Fipexide Betamipron Sulbentine Imazalil Benzbromarone Menbutone Fenbufen Empty
b Empty Tolperisone (hydrochloride) 3-Methyl-7-chloro-1,2,4-benzothiadiazine 1,1-dioxide Eprodisate (disodium) Lipoamide Broxaldine Denatonium (benzoate) Diloxanide furoate Furaltadone (hydrochloride) Bacampicillin (hydrochloride) Clofoctol Empty
c Empty Climbazole Piperacetazine Glafenine (hydrochloride) Penbutolol (sulfate) Cefradine Trioxsalen Imidazolidinyl urea Nitroxoline p-Phenylene diisothiocyanate Methoprene Empty
d Empty Sulisobenzone Fluroxene Cyproheptadine (hydrochloride sesquihydrate) Cefamandole (nafate) Ajmaline Timonacic Cyclandelate Lactulose (+)-Camphor Bekanamycin Empty
e Empty Ticarcillin (disodium) Crotamiton Cotinine Dipyrocetyl Chromocarb Hydrocortisone (acetate) Beclamide Propantheline (bromide) Cefadroxil Nanofin Empty
f Empty Estradiol (benzoate) Terfenadine Tetramisole (hydrochloride) Nialamide Pralidoxime (chloride) Tiratricol Alrestatin Fludrocortisone (acetate) Histamine Atropine Empty
g Empty Neostigmine (methyl sulfate) Urethane Carbamoylcholine (chloride) Etofylline Pipemidic acid Dehydroacetic acid Broxyquinoline Trimipramine (maleate) Prednisolone (21-acetate) Dimenhydrinate Empty
h Empty Oxeladin (citrate) Bronopol Sulfaphenazole Metrifonate Flufenamic acid Sisomicin (sulfate) Anethole (trithione) Promazine (hydrochloride) Carprofen Ribostamycin (sulfate) Empty

Plate layout: HY-L001P-Part A-52

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Heptaminol (hydrochloride) Metyrapone Octodrine (hydrochloride) Octinoxate Acetohydroxamic acid Sulfacarbamide Drofenine (hydrochloride) Droperidol Dihydrostreptomycin (sulfate) Propoxycaine (hydrochloride) Empty
b Empty Dimetridazole Salsalate Thonzonium (bromide) Protoporphyrin IX Chlorhexidine Trichlormethine (hydrochloride) Chlormethine (hydrochloride) Cefuroxime (sodium) Cefmetazole (sodium) 4-(Aminomethyl)benzoic acid Empty
c Empty 6-Acetamidohexanoic acid Cetrimonium (bromide) Sulfaguanidine Docusate (Sodium) Desipramine hydrochloride Cinromide Cephalothin (sodium) Trihexyphenidyl (hydrochloride) DL-α-Tocopherol acetate Nikethamide Empty
d Empty Mepyramine maleate Sulfaquinoxaline sodium salt Mephenesin 4-Chloro-3-methylphenol Piperacillin (sodium) Citalopram (hydrobromide) Cetylpyridinium (chloride monohydrate) Iodipamide Citric acid (trilithium salt tetrahydrate) Cephalosporin C zinc salt Empty
e Empty Cefonicid (sodium) Quinidine hydrochloride monohydrate Mebhydrolin (napadisylate) Mebhydrolin (-)-Sparteine (sulfate pentahydrate) Chloropyramine hydrochloride 4-Aminohippuric acid Zoxazolamine Proadifen (hydrochloride) Pramocaine (hydrochloride) Empty
f Empty Amodiaquin (dihydrochloride dihydrate) Oxiconazole nitrate Bemegride Chlortetracycline (hydrochloride) Apramycin (sulfate) Proglumide Cyromazine Perhexiline maleate Furazolidone Choline (chloride) Empty
g Empty Carbadox Retinol Oxantel (pamoate) Piroctone olamine Clorprenaline hydrochloride Fusidic acid (sodium salt) L-Ornithine Paroxypropione Digitoxin Lincomycin (hydrochloride hydrate) Empty
h Empty Chlorquinaldol Estropipate Iopromide Hydroxychloroquine sulfate 2,2,2-Tribromoethanol Florfenicol Ethosuximide Cefixime Pempidine Dichlorisone acetate Empty

Plate layout: HY-L001P-Part A-53

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Sulfamethoxypyridazine Homatropine (methylbromide) Lactitol (monohydrate) D-Panthenol Esmolol (hydrochloride) Dehydrocholic acid Nefazodone (hydrochloride) 4-Aminoantipyrine 3-Methylsalicylic acid Diiodohydroxyquinoline Empty
b Empty Dienestrol Dehydroisoandrosterone 3-acetate Acetrizoic acid Phthalylsulfathiazole Salicylanilide Ioversol i-Inositol Eprobemide Chloroxylenol Clofibric acid Empty
c Empty Nortriptyline (hydrochloride) Tazobactam Salicyl alcohol 9-Aminoacridine Benzthiazide Ethoxyquin 2-Ethoxybenzamide Chlorpropamide Butamben Butylparaben Empty
d Empty 7-Aminocephalosporanic acid Moxisylyte (hydrochloride) Nifuroxazide Canrenone Acetylleucine Isoconazole (nitrate) Esomeprazole magnesium Benidipine (hydrochloride) Uridin Imidapril (hydrochloride) Empty
e Empty (±)-Carnitine (chloride) Sulconazole (nitrate) Deoxyarbutin Chlorzoxazone Mezlocillin (sodium) Domiphen (bromide) 8-Azaguanine Isosorbide Azaperone Deoxycorticosterone (acetate) Empty
f Empty Serotonin hydrochloride Emetine (dihydrochloride hydrate) Ethoxzolamide Moxalactam (sodium salt) Procyclidine (hydrochloride) Tolmetin (sodium dihydrate) Imipramine (hydrochloride) Tranylcypromine (hemisulfate) Acefylline Vitamin K4 Empty
g Empty Acrivastine cAMP α-Cyclodextrin Alprenolol Alprenolol (hydrochloride) Anabasine Fuchsine base (monohydrochloride) Benactyzine hydrochloride Benzamil hydrochloride Benzetimide (hydrochloride) Empty
h Empty L-Canavanine sulfate (Z)-Capsaicin Carbinoxamine maleate salt Ceftizoxime Chlorphenoxamine Clebopride (malate) Clenbuterol (hydrochloride) Corticosterone Sodium diethyldithiocarbamate Flavin Adenine Dinucleotide Disodium Empty

Plate layout: HY-L001P-Part A-54

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Fosphenytoin (disodium) Iopanoic acid Nifursol Norethindrone acetate Oxiracetam Proxyphylline Puromycin (Dihydrochloride) Pyridoxal phosphate Quinidine Rotenone Empty
b Empty Sodium Fluoride Succimer Spermidine Sucrose Sulfachloropyridazine Sulfisomidin Terconazole Tosufloxacin (tosylate hydrate) Triclocarban Triethanolamine Empty
c Empty Spectinomycin (dihydrochloride pentahydrate) Dexamethasone phosphate disodium Afloqualone Forchlorfenuron Terbuthylazine Simetryn Imazapic Kasugamycin (hydrochloride hydrate) Oxadiazon Bromfenac (sodium hydrate) Empty
d Empty Cefetamet pivoxil (hydrochloride) Levodropropizine Menadione bisulfite (sodium) Metadoxine Methylprednisolone succinate Diaveridine Midecamycin Acetylspiramycin Dihydroisotanshinone I Josamycin Empty
e Empty Diniconazole Quizalofop-p-ethyl Napropamide Terbutryn Thifluzamide Fenoxaprop-P-ethyl Carbosulfan Cloquintocet-mexyl Phosalone Pyriproxyfen Empty
f Empty Benfluralin Trifluralin Tolclofos-methyl Tiamulin (fumarate) Carboxin Clofentezine Methylbenactyzium Bromide Fursultiamine Glycerol phenylbutyrate Oxyphenisatine Empty
g Empty Bromisoval Sulfogaiacol Osalmid Valpromide Sodium tauroglycocholate 6-Methoxy-2-naphthoic acid Azobenzene Uric acid Tryptamine Tannic acid Empty
h Empty S-(+)-Ketoprofen Ethopabate Bendazol Scopolamine N-oxide hydrobromide 2-Aminobenzenesulfonamide Myclobutanil Quadrol Loxiglumide Menaquinone-4 Robenidine hydrochloride Empty

Plate layout: HY-L001P-Part A-55

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Bendazac L-Lysine Docosahexaenoic Acid Mequitazine Octenidine (dihydrochloride) Ethacridine (lactate) Aspirin Aluminum ATP Apronal Cloperastine fendizoate Sofalcone Empty
b Empty Piperazine adipate S-Methyl-L-cysteine Sodium gualenate γ-Oryzanol Gefarnate Glycol salicylate Hydroxocobalamin hydrochloride Dibenzoyl Thiamine Dimemorfan (phosphate) Stearic acid Empty
c Empty Thiamine nitrate Sodium copper chlorophyllin Sulbutiamine Hinokitiol Phosphorylcholine DL-Lysine Riboflavin Tetrabutyrate Tacrine hydrochloride hydrate Bathophenanthroline 5-Aminofluorescein Empty
d Empty 6-Aminofluorescein Pyranine 5(6)-Aminofluorescein 5-CFDA 3-Cyano-7-ethoxycoumarin 7ACC1 2,3-Diaminonaphthalene DiI DIDS sodium salt MQAE Empty
e Empty Fluorescein-5-maleimide Quinine Thiazole Orange 2'-Deoxycytidine 2'-Deoxyuridine Ponceau 4R (RS)-Carbocisteine Phenolphthalein Thioflavin T Congo Red Empty
f Empty Sunset Yellow FCF Fluorescein o-Dianisidine (dihydrochloride) Tartrazine Erythrosin B Amaranth Rhodamine 6G Disperse Blue 148 Cardiogreen Fluorescamine Empty
g Empty Fluorescein Diacetate Lucigenin 6-CFDA 5(6)-CFDA 5(6)-TAMRA SE Calmagite Biotin NHS DAPI (dihydrochloride) CY5-SE Zy3 carboxylic acid Empty
h Empty CY7 WST-8 Imidazole Glutathione oxidized Tartaric acid (disodium dihydrate) Sodium molybdate Sodium orthovanadate Glycylglycine 1-Methyl-7-nitroisatoic anhydride Fast Green FCF Empty

Plate layout: HY-L001P-Part A-56

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Brilliant Blue FCF Methoxy-PMS H2DCFDA Procion Blue HB Diphenyl Blue Sulfo-SMCC (sodium) Biotin-DADOO TMRM Perchlorate NADH (disodium salt) NADP (sodium salt) Empty
b Empty NADPH (tetrasodium salt) NADPH (tetracyclohexanamine) β-Nicotinamide mononucleotide Iloperidone metabolite Hydroxy Iloperidone Omeprazole metabolite Omeprazole sulfide Norgestimate metabolite Norelgestromin N-Desmethylclozapine Galanthaminone Solifenacin (hydrochloride) Epiandrosterone Empty
c Empty Canagliflozin (hemihydrate) N-Acetylneuraminic acid Sodium 4-aminosalicylate dihydrate PCL 016 Regorafénib N-oxyde (M2) Uracil L-Alloisoleucine (-)-Epicatechin (-)-Epicatechin gallate Honokiol Empty
d Empty Oridonin Curcumin Demethoxycurcumin Bisdemethoxycurcumin Geniposide Geniposidic acid Baohuoside I Glycitin Icariin Astragalin Empty
e Empty Glycitein Daidzin Daidzein Echinacoside Verbascoside Isoacteoside Forsythoside B Poliumoside Arctiin Arctigenin Empty
f Empty Costunolide Albiflorin Alantolactone Ginsenoside Rb1 Ginsenoside Rb2 Ginsenoside Rc Ginsenoside Rd Ginsenoside Re Ginsenoside Rg1 Nuciferine Empty
g Empty Psoralen Osthole Chlorogenic acid 3,5-Dicaffeoylquinic acid 3,4-Dicaffeoylquinic acid 4,5-Dicaffeoylquinic acid Ferulic acid Ferulic acid (sodium) Macelignan Eucalyptol Empty
h Empty Solamargine Sarsasapogenin Bilobalide Ginkgolic Acid Praeruptorin B Betulin Betulinaldehyde Dimethylfraxetin N6-Methyladenosine Gambogic Acid Empty

Plate layout: HY-L001P-Part A-57

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Apocynin Schisandrin B Hypoxanthine Inosine Ancitabine (hydrochloride) Ipriflavone (S)-10-Hydroxycamptothecin Rotundine Guanosine Vanillin Empty
b Empty Astragaloside A Naringenin Neohesperidin Isoliquiritigenin Curcumol Rhein Danshensu (sodium salt) Salidroside Palmatine (chloride) Coenzyme Q10 Empty
c Empty Dihydromyricetin Evodiamine Gastrodin Hematoxylin Indirubin Lappaconitine (hydrobromide) Naringin Dihydrochalcone Polydatin Aloin Dioscin Empty
d Empty Diosmetin Yohimbine (Hydrochloride) Stigmasterol Synephrine (hydrochloride) Tangeretin Tanshinone I Taxifolin Theobromine Troxerutin Ursolic acid Empty
e Empty Parthenolide Phloretin Phlorizin Piperine Puerarin Rutaecarpine Rutin Salicin Monensin sodium salt Naringin Empty
f Empty Neohesperidin dihydrochalcone Nobiletin Oleanolic Acid Orotic acid Oxymatrine Paeonol Kinetin Luteolin Magnolol Matrine Empty
g Empty Gynostemma Extract Hesperetin Indole-3-carbinol Beta-Sitosterol Caffeic acid Cinchonidine Cryptotanshinone Dihydroartemisinin Diosmin 18β-Glycyrrhetinic acid Empty
h Empty Fisetin Formononetin Glycyrrhizic acid Indole-3-butyric acid 4-Methylumbelliferone Aloe emodin Amygdalin Andrographolide Arbutin Artesunate Empty

Plate layout: HY-L001P-Part A-58

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Azomycin Baicalein Baicalin Nordihydroguaiaretic acid Atractylenolide I Atractylenolide II Atractylenolide III Pulchinenoside A Pulchinenoside C Cantharidin Empty
b Empty D-Galactose Peimine Peiminine L-Phenylalanine (+)-Bicuculline Daurisoline (-)-Epigallocatechin Epiberberine (chloride) 7-epi-Taxol Bavachalcone Empty
c Empty Bavachin Bavachinin Bakuchiol Corylin Atractyloside A Atractylodin Saikosaponin D Catharanthine Hederacoside C alpha-Hederin Empty
d Empty Hederagenin Epimedin A Epimedin B Cordycepin Hypaconitine Ononin Echinocystic acid Eleutheroside E Brassinolide Caffeic acid phenethyl ester Empty
e Empty Aconine Corosolic acid Diacerein Imperatorin Lycorine (hydrochloride) Mangiferin Paeoniflorin Protocatechuic acid Scopolamine (hydrobromide) Sinensetin Empty
f Empty Stachydrine Tetrahydropalmatine Idebenone 5-Aminolevulinic acid (hydrochloride) Salvianolic acid A Bilirubin Cholic acid L-Methionin alpha-Mangostin Eugenol Empty
g Empty Scopolamine (butylbromide) Scopoletin Dexamethasone 9,11-epoxide Methyl Paraben p-Coumaric acid Curdione (-)-Catechin gallate Cynarin Dihydrotanshinone I Columbianadin Empty
h Empty Bergapten Pachymic acid Licochalcone A Liquiritigenin D-Mannitol D-Mannose Galangin Homovanillic acid Rhynchophylline Columbin Empty

Plate layout: HY-L001P-Part A-59

1 2 3 4 5 6 7 8 9 10 11 12
a Empty L-Glutamine L-Citrulline L-Cystine Fructose Wogonin Ligustilide Artemether β-Carotene Trigonelline chloride Cucurbitacin B Empty
b Empty Cucurbitacin E Quercitrin Succinic acid Cinobufagin Sophoricoside Cycloastragenol Alismoxide Astragaloside IV Astragaloside I Astragaloside II Empty
c Empty Engeletin Progesterone Asiaticoside Neferine 5-O-Methylvisammioside Sinapine (thiocyanate) Acacetin DL-Arginine L-Arginine L-Arginine (hydrochloride) Empty
d Empty Cichoric Acid Rebaudioside A Rebaudioside C L-Lysine hydrochloride L-Hyoscyamine Triptophenolide Wilforlide A Reserpine Reserpine (hydrochloride) Phillygenin Empty
e Empty α-Lipoic Acid Gentiopicroside Lovastatin Astilbin Loganin Erianin Calycosin Calycosin-7-O-β-D-glucoside (-)-Gallocatechin gallate Gallic acid Empty
f Empty Ethyl gallate 1,2,3,4,6-Penta-O-galloyl-beta-D-glucopyranose Rosmarinic acid Morroniside Xylose Xylitol Cynaroside Pseudoginsenoside F11 Allantoin Gypenoside XVII Empty
g Empty Oroxylin A Lathyrol Doxycycline (hyclate) Hydroxysafflor yellow A Madecassoside Umbelliferone Apigenin 7-glucoside Hydrocortisone Anisodamine Corynoxeine Empty
h Empty Dehydrocostus Lactone Deoxycholic acid Deoxycholic acid sodium salt Genistin Panaxadiol Panaxatriol Ginsenoside F1 Ginsenoside Rf Ginsenoside Rg2 Ginsenoside Rg3 Empty

Plate layout: HY-L001P-Part A-60

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Ginsenoside Rh1 Ginsenoside Rh2 Ginsenoside Ro Cinnamic acid Sucralose Notoginsenoside R1 Mulberroside A Morusin Maslinic acid Cimifugin Empty
b Empty Kuromanin (chloride) α-L-Rhamnose monohydrate Carnosol Dicoumarol L-Serine 2,3,5,4'-Tetrahydroxystilbene 2-O-β-D-glucoside Pinoresinol Diglucoside Jujuboside A Amentoflavone Aucubin Empty
c Empty Aspartic acid (calcium) L-Asparagine Rubusoside Tenacissoside H Dehydrocorydaline (chloride) Icaritin Retinyl acetate Thiamine hydrochloride D-Pantothenic acid (hemicalcium salt) (+)-α-Tocopherol Empty
d Empty Vitamin K1 Schisandrin C Schisandrin Schisandrol B Schisandrin A Schisantherin A Sipeimine alpha-Asarone Vanillic acid Coumarin Empty
e Empty alpha-Cyperone Berbamine (dihydrochloride) Neobavaisoflavone Neochlorogenic acid Mesaconitine seco-Isolariciresinol Diglucoside Linoleic acid Glucosamine (hydrochloride) Coptisine (chloride) Harmine Empty
f Empty Stachydrine hydrochloride Betaine (hydrochloride) Leonurine Leonurine (hydrochloride) Oxypaeoniflorin Monocrotaline Scutellarin Scutellarein Bornyl acetate 8-O-Acetyl shanzhiside methyl ester Empty
g Empty Angelicin Isorhynchophylline Isoquercitrin Isovitexin Isocorynoxeine Isorhamnetin Isoalantolactone Eupatilin Ginkgolide B Ginkgolide C Empty
h Empty Cryptochlorogenic acid Lupeol Tectorigenin Protopine (20S)-Protopanaxadiol 20(R)-Protopanaxatriol Alisol B (23-acetate) Camphor Timosaponin AIII Phytic acid Empty

Plate layout: HY-L001P-Part A-61

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Resibufogenin Chikusetsusaponin Iva Catalpol Shikonin Pterostilbene Palmitic acid L-Hisidine (20S)-Protopanaxatriol Jervine Veratramine Empty
b Empty Cephalotaxlen Epibrassinolide Dictamine Benzoylpaeoniflorin Alisol A Alisol A (24-acetate) Gomisin G Harringtonine Methyl protodioscin Ingenol Empty
c Empty 20-Deoxyingenol Isosteviol Arenobufagin Bufalin Bufotalin Cinobufotalin Gamabufotalin Aloin B Tubeimoside I AKBA Empty
d Empty Tetrahydrocurcumin Octahydrocurcumin Catechin Corynoxine Corynoxine B Dihydrochelerythrine Ginsenoside C-K Notoginsenoside Ft1 Rehmannioside D Manninotriose Empty
e Empty Ajugol Corydaline Tetrahydroberberine Columbamine Santacruzamate A Androsterone Ligustrazine (hydrochloride) Coixol Safflower yellow beta-Mangostin Empty
f Empty Xanthohumol Thymidine Apigenin Squalene Herniarin DL-Borneol (+)-Borneol (-)-Borneol Magnolin Syringaldehyde Empty
g Empty 2-Methoxybenzoic acid 6-Methylcoumarin trans-Trimethoxyresveratrol 1,3-Dicaffeoylquinic acid β-Caryophyllene Sesamol Glycocholic acid Glycoursodeoxycholic acid Raspberry ketone Glycodeoxycholic acid monohydrate Empty
h Empty Citric acid Oxyresveratrol Complanatuside Betulonic acid Campesterol (-)-Fucose 7beta-Hydroxylathyrol Ursonic acid Oleanonic acid Nystose Empty

Plate layout: HY-L001P-Part A-62

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Loureirin B Loureirin A Pyrogallol Halofuginone Halofuginone (hydrobromide) L-Praziquanamine 4',5-Dihydroxyflavone 4-Hydroxyphenylacetic acid Danshensu Dihydrocoumarin Empty
b Empty Pristimerin D(+)-Raffinose pentahydrate Icariside I Ailanthone Homoplantaginin Hispidulin Veratric acid Methyl gallate Anacardic Acid Castanospermine Empty
c Empty Maltose monohydrate Propylparaben Taurochenodeoxycholic acid 2,2':5',2''-Terthiophene (-)-Securinine Perillartine Isoginkgetin Isosakuranetin Combretastatin A4 Cytosporone B Empty
d Empty Pleuromutilin Fucoxanthin Ibotenic acid Podocarpic acid Methyllycaconitine citrate Glycochenodeoxycholic acid 11beta-Hydroxyprogesterone Cholesteryl behenate D-(+)-Melezitose Palmitelaidic Acid Empty
e Empty p-Hydroxycinnamic acid Gigantol 1-Kestose D-Arabitol Glucoraphanin 7-Hydroxy-4H-chromen-4-one 6,2'-Dihydroxyflavone 3'-Methoxyflavonol 6-Methylflavone 7-Methoxyisoflavone Empty
f Empty Lysipressin Aprotinin Pepstatin Trifluoroacetate Z-Gly-Gly-Arg-AMC (acetate) Cyclo(-RGDfK) Fertirelin Tyr-Gly-Gly-Phe-Met-OH TRAP-6 Neuromedin N Ornipressin Empty
g Empty Angiotensin II 5-valine Gramicidin Endomorphin 1 Phe-Met-Arg-Phe amide trifluoroacetate RGD Trifluoroacetate [Leu5]-Enkephalin [Des-Arg9]-Bradykinin (acetate) H-Lys-Trp-Lys-OH Nisin JMV 2959 hydrochloride Empty
h Empty Protein kinase inhibitors 1 hydrochloride JPH203 Dihydrochloride PK11007 3,4-Dihydroxybenzeneacetic acid Pyrrole-2-carboxylic acid 2,5-Furandicarboxylic acid L-Homoserine 4-Hydroxy-3-methylbenzoic acid 2-(4-Methoxyphenyl)acetic acid BIBR 1087 SE Empty

Plate layout: HY-L001P-Part A-63

1 2 3 4 5 6 7 8 9 10 11 12
a Empty 5-Hydroxymethyluracil 5-Hydroxymethyl-2-furancarboxylic acid 3-Methyl-2-oxobutanoic acid Tyramine 3-Oxopentanedioic acid 2-Oxobutanoic acid H-Phe-Phe-OH 2-Hydroxy-3-methylbutanoic acid Phloracetophenone 5-Hydroxyindole-3-acetic acid Empty
b Empty (+)-Sparteine Olivetol H-Tyr(3-I)-OH Glutaric acid DL-Homocystine 5-Methyluridine Terephthalic acid 7-​Hydroxy-​3,​4-​dihydro-​2(1H)​-​quinolinone 4,6-Dioxoheptanoic acid 2-Methylsuccinic acid Empty
c Empty Creatine Thymine DL-Norvaline H-Abu-OH Adenosine 5'-diphosphate Ethyl docosa-4,7,10,13,16,19-hexaenoate Xanthosine Tulobuterol hydrochloride Dodecanedioic acid N-Acetyl-L-tyrosine Empty
d Empty H-D-Trp-OH 2-Oxo-3-phenylpropanoic acid 2,4-Dihydroxybenzoic acid 3-Amino-4-methylpentanoic acid H-HoPro-OH 4-Methylcatechol 4-Ethylphenol 3-Nitropropanoic acid 3-Amino-2-methylpropanoic acid 3-Methylbutanoic acid Empty
e Empty S-Allyl-L-cysteine 2-Ketoglutaric acid Undecanedioic acid Ac-Arg-OH WS-3 Decanedioic acid 1,3-Dimethyluric acid 2-(2-Methylbenzamido)acetic acid 3-Indolepropionic acid Octanedioic acid Empty
f Empty Desaminotyrosine N-Isovaleroylglycine 3,5-Dihydroxybenzoic acid 2-Hydroxyphenylacetic acid 2-Phenylpropionic acid L-(+)-Arabinose 2-Benzoxazolinone 2-Hydroxy-2-methylbutanoic acid Fumaric acid Glycolic acid Empty
g Empty Chelidamic acid Hippuric acid Watermelon ketone L-Gulono-1,4-lactone trans-Aconitic acid 4-Chlorosalicylic acid H-Gly-Pro-OH 1-Methyl-L-histidine 3-Methyl-L-histidine L-Ornithine Hydrochloride Empty
h Empty 7-Methylxanthine Xanthine Adipic acid 2-Methylpentanedioic acid S-Adenosyl-L-methionine disulfate tosylate Traxoprodil 4(3H)-Quinazolinone L-Arabinitol 2'-Deoxyadenosine 3-Chloro-L-tyrosine Empty

Plate layout: HY-L001P-Part A-64

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Phenylacetylglutamine (S)-3-Hydroxybutanoic acid (R)-3-Hydroxybutanoic acid (±) Anabasine Rhodamine B L-Norleucine 3-Hydroxypicolinic acid 5-(Hydroxymethyl)furan-2-carbaldehyde Oxindole N-Acetylglycine Empty
b Empty 2-Naphthol D(-)-2-Aminobutyric acid Methyl Salicylate 6-Chloropurine L-Proline Benzocaine Isatin Urea p-Hydroxybenzaldehyde L-Cysteine Empty
c Empty Maleic Acid Dulcite L-Lactic acid DL-Serine N-Methylsarcosine 5-​Methylfurfural Pipecolic acid 3,4-Dimethoxyphenylacetic acid Pyruvic acid 2,6-Dihydroxybenzoic acid Empty
d Empty Levulinic acid 4-Hydroxybenzyl alcohol Methyl 2-​furoate Glycine (S)-2-Hydroxysuccinic acid Pimelic acid 2'-Hydroxyacetophenone Empty Empty Empty Empty
e Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
f Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
g Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
h Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty

Plate layout: HY-L001P-Part B-1

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Calcipotriol Calcipotriol (monohydrate) Calcitriol Alfacalcidol Bromobimane Mitoquinone (mesylate) SPDP E4CPG Nigericin (sodium salt) Maropitant Empty
b Empty Acriflavine Asaraldehyde Bisantrene Biotin-VAD-FMK (2-Hydroxypropyl)-β-cyclodextrin Sodium ionophore III THK5351 γ-Glu-Phe Methyl-β-cyclodextrin BETd-260 Empty
c Empty Dabigatran Protein degrader 1 (hydrochloride) RG7800 Ac-Gly-BoroPro N6-(2-Phenylethyl)adenosine NucPE1 Sulforhodamine 101 Biotin LC hydrazide Cresyl Violet acetate DiBAC4(3) Empty
d Empty Dihydrofluorescein diacetate Heparan Sulfate CU-CPT17e (±)-ANAP hydrochloride CB-1158 Hydrochloride Everolimus Rapamycin Edoxaban (tosylate monohydrate) Toceranib Toceranib (phosphate) Empty
e Empty E3 ligase Ligand 2 E3 ligase Ligand 3 E3 ligase Ligand-Linker Conjugates 12 E3 ligase Ligand-Linker Conjugates 13 E3 ligase Ligand-Linker Conjugates 3 E3 ligase Ligand-Linker Conjugates 4 E3 ligase Ligand-Linker Conjugates 5 E3 ligase Ligand-Linker Conjugates 6 E3 ligase Ligand-Linker Conjugates 7 E3 ligase Ligand-Linker Conjugates 8 Empty
f Empty E3 ligase Ligand-Linker Conjugates 9 E3 ligase Ligand-Linker Conjugates 10 E3 ligase Ligand-Linker Conjugates 11 E3 ligase Ligand-Linker Conjugates 14 E3 ligase Ligand-Linker Conjugates 15 E3 ligase Ligand-Linker Conjugates 16 E3 ligase Ligand-Linker Conjugates 17 E3 ligase Ligand-Linker Conjugates 18 RT-NH2 Ensartinib hydrochloride Empty
g Empty Pyrotinib Pyrotinib Racemate Colestyramine A 83-01 Gatifloxacin Rat orexin A PKI-402 Enbucrilate Kynurenic acid (sodium) Harmaline Empty
h Empty Xylan Real Thiol Avelumab DPPC Calf thymus DNA Risperidone DBCO-(PEG)3-VC-PAB-MMAE Amine-PEG3-Biotin Diphenylterazine E260 Empty

Plate layout: HY-L001P-Part B-2

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Chitosan oligosaccharide (COS) KRN5 UM-164 AST2818 mesylate Cholesteryl oleate Semaglutide (TFA) SB 216763 PIK-90 LDN193189 L-NIL Empty
b Empty 3-Deazaneplanocin A (hydrochloride) PI-1840 AMG 232 ML216 Val-cit-PAB-OH NMS-P715 Gilteritinib hemifumarate A-1210477 BMH-21 (S)-Willardiine Empty
c Empty CX546 Peptide M Peptide 401 Triptorelin Sermorelin Alisporivir Molidustat SAG Brigatinib C527 Empty
d Empty Torin 1 1alpha-Hydroxy VD4 MG-132 JTC-801 Impurity B of Calcitriol Impurity C of Calcitriol Impurity C of Alfacalcidol CX-5461 Dorsomorphin U-73122 Empty
e Empty Eribulin mesylate Exendin-4 Exendin-4 (Acetate) Droxidopa ATN-161 (trifluoroacetate salt) Blonanserin Buserelin (Acetate) Cyproterone (acetate) (R)-Lansoprazole Folinic acid (Calcium) Empty
f Empty 6-Mercaptopurine Miltefosine Pirarubicin Ebselen Streptozocin Tacrolimus Tetrandrine UNC 0631 Tenofovir IWP-2 Empty
g Empty Sevelamer hydrochloride Cisapride Cimetidine Fosaprepitant (dimeglumine) Methylene Blue Quetiapine Amisulpride Tandospirone Rosiglitazone (maleate) Aspirin Empty
h Empty Ipragliflozin Opicapone SRT 1720 (Hydrochloride) 1alpha, 24, 25-Trihydroxy VD2 Calcitetrol D8-MMAE Guadecitabine sodium 3-O-(2-Aminoethyl)-25-hydroxyvitamin D3 SRT 2104 Impurity F of Calcipotriol Empty

Plate layout: HY-L001P-Part B-3

1 2 3 4 5 6 7 8 9 10 11 12
a Empty 24R-Calcipotriol (24R)-MC 976 (24S)-MC 976 Prasugrel Doxercalciferol-D3 Maxacalcitol-D6 VD2-D3 VD3-D6 Alfacalcidol-D6 Tetrahydrouridine Empty
b Empty Copanlisib Tazarotene Cholecalciferol Rimegepant JC-1 Hoechst 33342 (trihydrochloride) HOE 32021 HOE 33187 Dolastatin 10 meta-iodoHoechst 33258 Empty
c Empty Hoechst 33258 analog 2 Hoechst 33258 analog 3 ortho-iodoHoechst 33258 Hoechst 33258 analog 5 Hoechst 33258 analog 6 PSI-7409 Osimertinib mesylate LP-533401 hydrochloride AMG 925 TMB Empty
d Empty 6-TAMRA SM-164 Aldoxorubicin Lurbinectedin Abemaciclib Talaporfin (sodium) TAS-102 Transcrocetinate disodium ITX3 Indoximod Empty
e Empty RO9021 CEP dipeptide 1 Esomeprazole (Magnesium trihydrate) Cyclopamine Besifloxacin (Hydrochloride) Medetomidine Naphthoquine (phosphate) Levomefolate (calcium) Carboplatin Cisplatin Empty
f Empty Strontium Ranelate Nisoldipine Minocycline (hydrochloride) Ifosfamide Cyclophosphamide Cyclophosphamide (hydrate) Fosamprenavir (Calcium Salt) Amicarbazone Actinomycin D Heparin (sodium salt) Empty
g Empty Atosiban Penicillin G (potassium) Tavilermide Lisinopril (dihydrate) 1-Naphthaleneacetic acid BI 224436 Galidesivir Coelenterazine Cobalt phthalocyanine Examorelin Empty
h Empty Fmoc-Val-Cit-PAB GW4869 alpha-Amanitin LED209 Mertansine LTX-315 TD139 Potassium clavulanate cellulose Mc-Val-Cit-PABC-PNP 6-Quinoxalinecarboxylic acid, 2,3-bis(bromomethyl)- Empty

Plate layout: HY-L001P-Part B-4

1 2 3 4 5 6 7 8 9 10 11 12
a Empty E3 Ligase Ligand-Linker Conjugates 1 Tacalcitol Maxacalcitol Seocalcitol Falecalcitriol Secalciferol Doxercalciferol Ercalcidiol Ercalcitriol Calcifediol (monohydrate) Empty
b Empty Fmoc-Val-Cit-PAB-PNP E3 ligase Ligand 4 E3 ligase Ligand 1 BEZ235 Palbociclib Deforolimus Paricalcitol Trabectedin D149 Dye Esterase chromogenic substrate-1 Empty
c Empty Acetaminophen Moxifloxacin (Hydrochloride) Calcitriol Impurities A Vitamin D4 Bergaptol Paricalcitol-D6 24, 25-Dihydroxy VD2 Calcitriol D6 24, 25-Dihydroxy VD3 (S)-(+)-Ibuprofen Empty
d Empty MC-Val-Cit-PAB 6-Maleimidohexanoic acid N-hydroxysuccinimide ester Osimertinib (dimesylate) Eldecalcitol Tipiracil Teicoplanin Tunicamycin Hypromellose Tetracycline Gadopentetate (dimeglumine) Empty
e Empty Ceruletide Pentosan Polysulfate Polymyxin B (Sulfate) Sodium lauryl polyoxyethylene ether sulfate Gentamicin (sulfate) Ondansetron (hydrochloride dihydrate) Ondansetron Baclofen Lurasidone (Hydrochloride) Folinic acid (calcium salt pentahydrate) Empty
f Empty Prostaglandin E1 Risedronic acid Mizolastine Ellagic acid Sulfapyridine 6-Aminocaproic acid Chloramphenicol Meprednisone Hydrochlorothiazide Bacitracin (Zinc) Empty
g Empty Crystal Violet Liranaftate Ciprofloxacin Ciprofloxacin hydrochloride L-Carnitine Chlorpromazine (hydrochloride) Fleroxacin DL-Epinephrine L-Epinephrine Riboflavin Empty
h Empty Isoprenaline (hydrochloride) Tetracaine (hydrochloride) Carbenicillin (disodium) Clinafloxacin Procaine Procaine (hydrochloride) Bismuth Subsalicylate Hyaluronic acid sodium salt Hyaluronic acid Zofenopril (calcium) Empty

Plate layout: HY-L001P-Part B-5

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Urapidil Pilocarpine (Hydrochloride) Polaprezinc Cefotiam (hydrochloride) Promethazine (hydrochloride) AZ7550 hydrochloride AZ7550 Mesylate Lumefantrine Salicylamide Suramin (sodium salt) Empty
b Empty Rufloxacin (hydrochloride) Merbromin Penicillin V (Potassium) Oxolinic acid 4-Nonylphenol polyethoxylate Decoquinate Tyloxapol Lasalocid (sodium) Medrysone Clopidol Empty
c Empty Gliquidone Tiapride (hydrochloride) Metamizole (sodium hydrate) Adrenalone (hydrochloride) DL-Glutamine 4-Chloro-DL-phenylalanine Penicillin G sodium salt Ceftizoxime (sodium) Polyvinylpyrrolidone Cefpirome (sulfate) Empty
d Empty Oritavancin (diphosphate) Canthaxanthin Polidocanol Pancreatin Chitosan Chondroitin (sulfate) Amylase α-Amylase Gastric mucin Cellulase Empty
e Empty Proteinase Benzalkonium chloride Povidone iodine Lecithin Lysozyme from chicken egg white PLGA Bromothymol Blue Dansyl chloride Sudan I 7-Amino-4-methylcoumarin Empty
f Empty Calcein NBD-Cl 6-ROX Dihydroethidium 3,3'-Dihexyloxacarbocyanine iodide ATP-polyamine-biotin L-Glutathione reduced Leucocrystal violet Tris(4-aminophenyl)methane Solvent Blue 35 Empty
g Empty Tetrazolium Red Nile Red 5-ROX NBD-F Propidium (Iodide) Rhodamine 123 Rhodamine 110 CY3-SE Calcein (tetraethyl ester) CY5-N3 Empty
h Empty Bovine Serum Albumin β-Glycerol phosphate disodium salt pentahydrate DFO Heptamethine cyanine dye-1 4-Methylumbelliferyl-β-D-glucuronide hydrate SPQ CFSE 3,3'-Dioctadecyloxacarbocyanine perchlorate Thioflavine S TMRE Empty

Plate layout: HY-L001P-Part B-6

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Acridine Orange 10-Nonyl Bromide C-Phycocyanin Dansylcadaverine D-(+)-Glucono-1,5-lactone Protein A/G Magnetic Beads Sanguinarine (chloride) Solasodine Tanshinone IIA Diosgenin Theaflavin Empty
b Empty Lycopene L-DOPA Cholesterol L-Tyrosine Vincristine (sulfate) Prim-O-glucosylcimifugin Protodioscin Astragalus polysaccharide Salvianolic acid B Tanshinone IIA sulfonate (sodium) Empty
c Empty Tomatidine Cholesterol myristate Melanotan I Thymus factor X Nesiritide Cetrorelix (Acetate) Liraglutide Somatostatin Pepstatin Ammonium 5-Tamra-DRVYIHP Empty
d Empty Cyclo(RADfK) Insulin(human) Octreotide Enfuvirtide GLP-1(7-36) Acetate GLP-1(7-37) Tetracosactide Thymus peptide C Bax inhibitor peptide V5 Glucagon Empty
e Empty Corticotropin-releasing factor (human) Corticotropin-releasing factor (ovine) Human growth hormone-releasing factor Calcitonin (salmon) Thymalfasin Cecropin B Sincalide [D-Ala2]leucine-enkephalin Tat-NR2B9c Disitertide Empty
f Empty Lixisenatide ReACp53 iRGD peptide SPACE peptide Amyloid beta-peptide(25-35) PLP (139-151) Gap 27 SN50 Alexamorelin Alexamorelin Met 1 Empty
g Empty ARA290 GHRP-2 metabolite 1 TB500 BKT140 (4-fluorobenzoyl) Chlorotoxin(linear) 740 Y-P Nociceptin Senktide Bombesin Neurokinin A Empty
h Empty Neuropeptide Y (29-64), amide, human (TFA) Substance P Endothelin 1 (swine, human) Rat CGRP-(8-37) Autocamtide-2-related inhibitory peptide (TFA) PACAP (6-38), human, ovine, rat (TFA) FLAG peptide N-Formyl-Met-Leu-Phe Autocamtide 2 SHU 9119 Empty

Plate layout: HY-L001P-Part B-7

1 2 3 4 5 6 7 8 9 10 11 12
a Empty AZP-531 Melittin Neurotensin Gastrin-Releasing Peptide, human HA Peptide Tuftsin Neuromedin B Luteinizing Hormone Releasing Hormone (LH-RH), salmon Dermorphin Mastoparan Empty
b Empty Kemptide Neurotensin(8-13) α-Melanocyte-Stimulating Hormone (MSH), amide Kisspeptin-10 Trifluoroacetate Astressin Indolicidin Galantide Exendin (9-39) β-Amyloid (1-40) Melanotan (MT)-II Empty
c Empty Magainin 2 Proctolin Gastric Inhibitory Peptide (GIP), human Carcinoembryonic Antigen (CEA) TAT peptide Protease-Activated Receptor-2, amide OVA Peptide (323-339) QL9 GnRH-I Hexa-His Empty
d Empty Gly-Arg-Gly-Asp-Ser Protease-Activated Receptor-4 LSKL, Inhibitor of Thrombospondin (TSP-1) SLLK, Control Peptide for TSP1 Inhibitor(TFA) Crustacean Cardioactive Peptide (CCAP) PrP (106-126) Antennapedia Peptide(TFA) Arg-Gly-Glu-Ser(TFA) SV40 large T antigen NLS c-Myc Peptide Trifluoroacetate Empty
e Empty Arg-Gly-Asp-Cys Crosstide Interleukin (IL)-6 Receptor Hemorphin-7 3X FLAG peptide V5 Epitope Tag Peptide Trifluoroacetate Ac-DEVD-CHO Suc-Leu-Leu-Val-Tyr-AMC Ac-DEVD-AMC Luciferase Empty
f Empty Ac-DEVD-AFC Ac-DEVD-pNA [Sar9,Met(O2)11]-Substance P Deltorphin 2 HCGRP-(8-37) VIP(6-28)(human, rat, porcine, bovine) GLP-2(1-33)(human) M40 NFAT Inhibitor LEP(116-130)(mouse) Empty
g Empty Hexa-D-arginine MLCK inhibitor peptide 18 Hemokinin 1 (mouse) Angiotensin 1 (Human) [Pyr1]-Apelin-13 DAPTA Neuropeptide W-23(human) Compstatin Motilin (26-47), human, porcine PLP(139-151) Empty
h Empty Myelin Basic Protein (MBP) (68-82), guinea pig Lysozyme Adrenorphin Gastrin-1, human rGHRH(1-29)NH2 Exendin derivative 1 N-terminally acetylated Leu-enkephalin Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) KQMEEEAVRLFIEWLKNGGPSSGAPPPS HAEGTFTSDVS Empty

Plate layout: HY-L001P-Part B-8

1 2 3 4 5 6 7 8 9 10 11 12
a Empty VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS HAEGTFTSD SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS HAEGTFT FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS HAEGT GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS HAE Atrial Natriuretic Peptide (ANP) (1-28), rat Tertiapin-Q Empty
b Empty GLP-1 moiety from Dulaglutide Orexin B, rat, mouse Amyloid β Peptide (42-1)(human) Amyloid β-Peptide (1-42) (human) Neuronostatin-13 (human) Amyloid β-peptide (1-40) (rat) β-Amyloid (1-42), rat (TFA) HAEGTFTSDVSSYLE EAVRLFIEWLKNGGPSSGAPPPS Substance P (1-7)(TFA) Empty
c Empty β-Endorphin, human Angiotensin II (3-8), human (TFA) Adrenocorticotropic Hormone (ACTH) (1-10), human Leptin (22-56), human Cecropin A (TFA) Galanin (1-16), mouse, porcine, rat (TFA) G3-C12 (TFA) Dynorphin A (1-10) (TFA) ALX 40-4C Trifluoroacetate Cetuximab Empty
d Empty Bevacizumab Trastuzumab ATP-Red 1 L-Homocystine (-)-Sparteine DL-Glyceric Acid Lanosterol N,N-Dimethylacetamide Cellulose carboxymethyl ether sodium Formamide Empty
e Empty PEG300 PEG400 (±)-1,2-Propanediol Guanine Corn oil Sodium carboxymethyl cellulose Cremophor EL Tween 80 Gelucire 14/44 Solutol HS-15 Empty
f Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
g Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
h Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty

Plate layout: HY-L001P-Part C-1

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Fumarate hydratase-IN-1 Fumarate hydratase-IN-2 (sodium salt) Peretinoin SR-3029 (1R,2R)-2-PCCA(hydrochloride) KDM5A-IN-1 BAY1125976 Rogaratinib Tomivosertib PQR620 Empty
b Empty Bay 41-4109 Bay 41-4109 (racemate) NSC5844 9-Propenyladenine (Z)-9-Propenyladenine Dolutegravir intermediate-1 SCH 563705 WEHI-345 analog TA-02 BW-A 78U Empty
c Empty N-[(4-Aminophenyl)methyl]adenosine Taranabant racemate Taranabant ((1R,2R)stereoisomer) E 2012 SCH 546738 GSK2239633A DSM265 SAR-100842 GSK-2881078 PI4KIIIbeta-IN-10 Empty
d Empty HUHS015 A-196 CP21R7 TAPI-2 CZ415 Aloxistatin CI-1044 Tyrosine kinase-IN-1 PCI-33380 AC260584 Empty
e Empty M2I-1 Ibrutinib-biotin GNE-495 PK14105 CA-074 methyl ester AQ-13 dihydrochloride MELK-8a (hydrochloride) Val-Cit-PAB-MMAE TPO agonist 1 FPTQ Empty
f Empty SHP099 (hydrochloride) BCRP-IN-1 CFMTI DFMTI GNF-6231 Linaprazan Soraprazan UKI-1 BFH772 KDM5-IN-1 Empty
g Empty Eltanexor Z-isomer IMR-1 IMR-1A Paquinimod (-)-PX20606 trans isomer CGP 25454A IC87201 GSK3179106 C29 PTP1B-IN-2 Empty
h Empty tBID NSC781406 Esaxerenone BTTAA TAK-243 BLU-554 SH5-07 FT011 GLPG0187 CC122 Empty

Plate layout: HY-L001P-Part C-2

1 2 3 4 5 6 7 8 9 10 11 12
a Empty FMK 9a XMU-MP-1 DprE1-IN-2 IDE1 SGC2085 MAL-di-EG-Val-Cit-PAB-MMAE Davercin Saponins BGG463 Revizinone Empty
b Empty BMS-986020 WNK463 FGFR4-IN-1 Roflumilast N-oxide Mycro 3 SP-13786 GNF-PF-3777 ML390 NOD-IN-1 TPOP146 Empty
c Empty HT-2157 BM212 GNE-272 AM-2099 BMT-145027 GSK9311 4E2RCat Lanabecestat S63845 GNE-140 (racemate) Empty
d Empty (R)-GNE-140 (S)-GNE-140 HDAC-IN-4 N-563 KR-33493 PBI-4050 (sodium salt) Pirmenol (hydrochloride) Rbin-1 TAS-120 OABK (hydrochloride) Empty
e Empty TN1 ASK1-IN-1 JQEZ5 ER-000444793 ABX464 N3-PEG3-vc-PAB-MMAE GGTI298 Acelarin MX69 ML364 Empty
f Empty VH-298 EC330 Olcegepant ARV-771 CXCR2-IN-1 CCT251236 GSK 4027 GSK4028 Q203 AZD7986 Empty
g Empty SMCC-DM1 Monastrol PD-1-IN-1 MK-8998 PF-06840003 KI696 SF2523 YKL-05-099 T807 JNJ-39758979 Empty
h Empty Ecteinascidin 770 CYC065 Evobrutinib BI 689648 S1p receptor agonist 1 Milademetan CHMFL-BMX-078 BAR502 BAR501 EMT inhibitor-1 Empty

Plate layout: HY-L001P-Part C-3

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Thiomyristoyl DMU2105 Pan-RAS-IN-1 Z-IETD-FMK CFI-402257 R-IMPP PZM21 Coproporphyrin III ST-193 ST-193 (hydrochloride) Empty
b Empty Trilaciclib hydrochloride (±)-Zanubrutinib Zanubrutinib (R)-Zanubrutinib Iclaprim CC-885 PDE1-IN-2 LY3214996 Pico145 F1063-0967 Empty
c Empty MBP146-78 GSK1059865 NMI 8739 MRX-2843 Avapritinib GDC-0077 AMG-176 BMS-986158 Roblitinib LXS196 Empty
d Empty MHP TPA 023 PSI-6130 Pagoclone Panidazole CERC-501 GSK2982772 TYK2-IN-2 PRN1371 EDO-S101 Empty
e Empty RG7800 hydrochloride BMS-935177 NCGC00244536 CP671305 SK1-IN-1 ND-646 ML-18 FITM AX-15836 TG 100572 (Hydrochloride) Empty
f Empty BMS-986142 MGAT2-IN-1 KKL-10 AU1235 INF39 Moniliformin (sodium salt) DS-1040 (Tosylate) IRAK4-IN-1 AVN-492 KDM4D-IN-1 Empty
g Empty hVEGF-IN-1 L-ANAP hydrochloride CM-4620 KIN1148 β-Apo-13-carotenone Inarigivir Ruboxistaurin (hydrochloride) AD80 Pseudothymidine Deoxypseudouridine Empty
h Empty XL041 LOXO-195 CPI-444 Lys-SMCC-DM1 IACS-9571 Hydrochloride Gamitrinib TPP hexafluorophosphate SB756050 A2A receptor antagonist 1 Antifungal agent 1 PI3Kδ-IN-2 Empty

Plate layout: HY-L001P-Part C-4

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Oxamflatin Hispidol FM381 JAK2 JH2 Tracer WM-8014 SAFit2 2OH-BNPP1 Retaspimycin (Hydrochloride) Ixabepilone Midostaurin Empty
b Empty AKT Kinase Inhibitor HSF1A HMN-154 SU5408 WZ4141 WZ4141R (+)-BAY-1251152 (±)-BAY-1251152 (-)-BAY-1251152 ML327 Empty
c Empty TLR7-agonist-1 SAGE-217 CLK1-IN-1 FAA1 agonist-1 T-3775440 hydrochloride inS3-54A18 Azaindole 1 Desidustat NSC232003 PD173212 Empty
d Empty BMS-690514 AV-412 AV-412 (free base) JNJ0966 MD2-IN-1 Takinib PROTAC CDK9 Degrader-1 PROTAC BET Degrader-1 (2R)-Octyl-α-hydroxyglutarate (2S)-Octyl-α-hydroxyglutarate Empty
e Empty CY-09 SSD114 hydrochloride Abiraterone metabolite 1 CD73-IN-1 TLR7/8 agonist 1 (dihydrochloride) Nezukone CT7001 hydrochloride Seclidemstat Eperezolid EP1013 Empty
f Empty S 38093 GSK2807 Trifluoroacetate Asciminib NecroX-5 Philanthotoxin 74 dihydrochloride ML402 IDH-305 LYC-55716 Dilmapimod MKC8866 Empty
g Empty Vorasidenib LM22B-10 QC6352 Pamapimod Pyrotinib dimaleate Ki20227 AZ960 Tyrosine kinase inhibitor A-443654 Balapiravir Empty
h Empty R-1479 SCH-1473759 (hydrochloride) Pevonedistat hydrochloride Tipifarnib (S enantiomer) HIV-1 integrase inhibitor 2 Varlitinib Evofosfamide Nelotanserin Temanogrel IMD-0560 Empty

Plate layout: HY-L001P-Part C-5

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Niraparib R-enantiomer Delcasertib Larazotide acetate Neu2000 Lck inhibitor 2 Rislenemdaz Voclosporin Letrazuril S 3304 PTP1B-IN-1 Empty
b Empty JNJ-10229570 PF-AKT400 G-1 CH7057288 MTX-211 (+)-Cloprostenol RF9 AX-024 AX-024 hydrochloride SKA-121 Empty
c Empty Tropifexor PAT-1251 MZ 1 Target Protein-binding moiety 4 A-485 MK-4074 Duocarmycin TM GSK656 Cyclic-di-GMP RIG-1 modulator 1 Empty
d Empty Calcium polystyrene sulfonate MF498 VU6005649 MK-3903 MM 07 CAY10650 SB-649868 Bitopertin (R enantiomer) GNE-493 DG051 Empty
e Empty GC7 Sulfate RK-24466 PF-06471553 PDD 00017273 Vipadenant WAY 316606 L-368,899 hydrochloride TM-N1324 RO-9187 CC-671 Empty
f Empty RT-AM N-Desethyl Sunitinib Leu-AMS Leu-AMS R enantiomer Morphothiadin Aminoacyl tRNA synthetase-IN-1 Salicyl-AMS Padsevonil Rosiptor Baloxavir marboxil Empty
g Empty Baloxavir Inarigivir soproxil Mavacamten Adavivint Delgocitinib Fulacimstat Parsaclisib Rovazolac Vecabrutinib Licogliflozin Empty
h Empty Nemorexant Pemigatinib Danegaptide Hydrochloride Camicinal Mibampator 5α-Pregnane-3β,6α-diol-20-one ASTX660 AZD1390 CA-4948 BM635 Empty

Plate layout: HY-L001P-Part C-6

1 2 3 4 5 6 7 8 9 10 11 12
a Empty NITD-349 BMS-813160 AS601245 A-770041 ZSET1446 PMX 205 Trifluoroacetate BMS-538203 N-Acetylcysteine amide KP-457 Capzimin Empty
b Empty GNE-477 SD 0006 BMS-509744 JNJ-38877618 GLPG1837 FL-411 LDH-IN-1 EZM 2302 MS417 Vabicaserin hydrochloride Empty
c Empty Synta66 BB-Cl-Amidine GPR120 Agonist 2 FN-1501 TES-1025 Casein Kinase II Inhibitor IV IDF-11774 TR antagonist 1 AZD7594 SR17018 Empty
d Empty GSK2643943A Porcupine-IN-1 AZD-0364 GDC-0927 INCB-057643 LMPTP INHIBITOR 1 (dihydrochloride) RGX-104 RGX-104 (free Acid) IPI-3063 dTRIM24 Empty
e Empty PF-06869206 SHIN1 AZD4573 LXH254 ABBV-744 WNK-IN-11 JH-VIII-157-02 PF-06751979 BOS-172722 IACS-8968 Empty
f Empty IACS-8968 (R-enantiomer) IACS-8968 (S-enantiomer) PRN1008 Tenalisib R Enantiomer KO-947 H3R-IN-1 Hydrochloride D-Lin-MC3-DMA Lerociclib dihydrochloride GNE-131 TAS6417 Empty
g Empty HC-070 Ripretinib NCGC00247743 MZP-54 MZP-55 Lith-O-Asp TRPM8 Antagonist QX77 RS-246204 HaloPROTAC 2 Empty
h Empty GSTO-IN-2 α-2,3-sialyltransferase-IN-1 GPR84 antagonist 8 6-(3-Methoxyphenyl)-4-methyl-2-(2-morpholinoethyl)pyridazin-3(2H)-one hydrochloride CC-90003 Ceftobiprole dBET6 TES-991 SIRT5 inhibitor BAY-2402234 Empty

Plate layout: HY-L001P-Part C-7

1 2 3 4 5 6 7 8 9 10 11 12
a Empty CG-806 GCN2iB RSV-IN-1 GLP-1 receptor agonist-1 Pradefovir mesylate AGL-2263 Neurotoxin Inhibitor 4'-Methylchrysoeriol EX229 NFAT Transcription Factor Regulator Empty
b Empty VTX-27 ONO-8590580 PH-002 AZD3229 Tosylate ON-013100 HS-10296 hydrochloride BI-409306 CNT2 inhibitor-1 Asp-AMS Gln-AMS (TFA) Empty
c Empty Arg-AMS UT-155 BI-671800 Pronase E Protac linker 5 PF-06873600 delta-Valerobetaine MA-0204 RCGD423 IDO-IN-12 Empty
d Empty AZD7507 Tyk2-IN-4 S55746 AKOS B018304 XMD-17-51 Trifluoroacetate PSMA-617 LY2109761 GSK369796 Dihydrochloride Umeclidinium (bromide) GW274150 Empty
e Empty Marimastat MEK inhibitor CDDO-EA NVP-2 MSI-1436 lactate CID-797718 Umbralisib R-enantiomer THZ2 GNE-9605 HG6-64-1 Empty
f Empty LY2857785 Sulfatinib (-)-Indolactam V c-di-AMP G-749 NIBR189 GK921 ETP-46321 ML355 ML365 Empty
g Empty TPPB PF 1022A BQ-123 ML224 MKC9989 CGP-42112 AMG-3969 BMS-983970 JNJ-47117096 hydrochloride BET-BAY 002 Empty
h Empty TAS-115 mesylate Zotarolimus 42-(2-Tetrazolyl)rapamycin DGAT1-IN-1 A-1165442 Beclabuvir INT-767 BDP5290 CDKI-73 Crenigacestat Empty

Plate layout: HY-L001P-Part C-8

1 2 3 4 5 6 7 8 9 10 11 12
a Empty FICZ TBK1/IKKε-IN-2 DM4 SPDB-DM4 Z-Ile-Leu-aldehyde Z-DEVD-FMK OTS-964 VLX1570 Vps34-IN-2 Mutant IDH1-IN-1 Empty
b Empty Epetraborole (hydrochloride) SAR405 R enantiomer TBA-354 LY2510924 VER-246608 GV-58 ITI214 Methoxy-PEPy cGAMP GSK-5498A Empty
c Empty PF-06380101 LGD-6972 Pyridoclax DBPR108 Deslorelin PNU-282987 (S enantiomer free base) Paritaprevir HSP70-IN-1 Rhosin (hydrochloride) GPR40 Activator 2 Empty
d Empty FAS-IN-1 (Tosylate) Mirogabalin MPI-0479605 PE859 PRN694 Mitapivat 5'-GTP trisodium salt hydrate EPZ015666 DC-05 DC_517 Empty
e Empty CARM1-IN-1 CARM1-IN-1 (hydrochloride) A-836339 6-OAU Hydroxy Itraconazole GSK805 Asivatrep Etrasimod hPGDS-IN-1 Raxatrigine hydrochloride Empty
f Empty AR-13324 M1 metabolite DiZPK Hydrochloride AF38469 Autotaxin modulator 1 PDE10-IN-1 Antibiotic-202 RNPA1000 BHPI Mcl1-IN-2 Sortin1 Empty
g Empty KH-CB19 Ampkinone EN460 p38 MAPK-IN-1 SAG (hydrochloride) Dasotraline (hydrochloride) Empesertib Brilanestrant PT-2385 Atuveciclib Racemate Empty
h Empty Atuveciclib Atuveciclib S-Enantiomer Nazartinib Nazartinib S-enantiomer IWP-4 PF 05089771 ADU-S100 ADU-S100 (ammonium salt) KDU691 GNE-3511 Empty

Plate layout: HY-L001P-Part C-9

1 2 3 4 5 6 7 8 9 10 11 12
a Empty NITD008 SKLB4771 EPZ020411 (hydrochloride) Nampt-IN-1 RG7713 ALS-8112 Lumicitabine Fagomine BI605906 HIV-1 integrase inhibitor Empty
b Empty GSK 525768A CDK-IN-2 Btk inhibitor 1 Btk inhibitor 1 (R enantiomer) Btk inhibitor 1 (R enantiomer hydrochloride) LX-1031 Telotristat Glucose-conjugated MGMT inhibitor Daun02 Sodium formononetin-3'-sulfonate Empty
c Empty MK-8245 Cobimetinib (racemate) Olodanrigan BOC-D-FMK Talabostat isomer mesylate LUF6000 LY2979165 AR-C155858 Silvestrol aglycone Silvestrol Empty
d Empty A-674563 A-674563 (hydrochloride) IRAK inhibitor 4 IRAK inhibitor 4 (trans) MK-8033 XL888 Tesevatinib Allitinib tosylate Tubacin Finafloxacin Empty
e Empty Avatrombopag VCH-916 MK-4256 USP7/USP47 inhibitor AC710 Epothilone A LY2608204 AVN-944 Banoxantrone (D12 dihydrochloride) Batimastat Empty
f Empty Piclidenoson Chidamide Crolibulin Exatecan (Mesylate) Incyclinide LY2334737 Meisoindigo Oleandrin Quinagolide (hydrochloride) XL019 Empty
g Empty Pirodavir LY 344864 (S-enantiomer) XL388 Epoxomicin AZD8797 AZD1080 Bisindolylmaleimide I IKK-IN-1 Etimizol Miquelianin Empty
h Empty S186 GLPG0634 analog Mutant IDH1 inhibitor GSK-3 inhibitor 1 Mutant EGFR inhibitor Nav1.7 inhibitor Merimepodib NVP-TNKS656 AP20187 6-[(3-Cyclobutyl-2,3,4,5-tetrahydro-1H-3-benzazepin-7-yl)oxy]-N-methylpyridine-3-carboxamide Empty

Plate layout: HY-L001P-Part C-10

1 2 3 4 5 6 7 8 9 10 11 12
a Empty R121919 Cinaciguat Cinaciguat (hydrochloride) Vernakalant (Hydrochloride) Siramesine (hydrochloride) Glucocorticoid receptor agonist BMS-191095 Ravuconazole Vilanterol (trifenatate) BMS-582949 (hydrochloride) Empty
b Empty Idalopirdine Hydrochloride MK-5046 EBE-A22 GSK163090 CB30865 ERK5-IN-1 Velneperit Cipargamin Asunaprevir Pyridone 6 Empty
c Empty MAC13243 DWK-1339 Talarozole K 01-162 TP-10 Necrostatin 2 Necrostatin 2 (racemate) Necrostatin 2 (S enantiomer) (-)-DHMEQ (+)-DHMEQ Empty
d Empty Soblidotin RO4987655 Ceftaroline fosamil Imeglimin (hydrochloride) Monepantel Nesbuvir Levomefolic acid Inolitazone (dihydrochloride) Palovarotene (+)-Talarozole Empty
e Empty (-)-Talarozole Tosedostat Amenamevir Karenitecin Indeglitazar Evatanepag Litronesib Litronesib (Racemate) Dipraglurant Omadacycline (hydrochloride) Empty
f Empty Remimazolam (benzenesulfonate) Verucerfont Bavisant (dihydrochloride hydrate) Cenicriviroc Cenicriviroc Mesylate Eliglustat Eliglustat (hemitartrate) Fabomotizole (hydrochloride) Capadenoson Migalastat (hydrochloride) Empty
g Empty Mirodenafil (dihydrochloride) Pardoprunox (hydrochloride) SQ109 EMD534085 AUZ 454 Sofosbuvir impurity A SSR240612 ELN-441958 MDL 105519 Staurosporine Empty
h Empty Tipranavir Romidepsin Bemcentinib Ro3280 Monomethyl auristatin E Glyoxalase I inhibitor Glyoxalase I inhibitor (free base) Collagen proline hydroxylase inhibitor EMD638683 (R-Form) EMD638683 (S-Form) Empty

Plate layout: HY-L001P-Part C-11

1 2 3 4 5 6 7 8 9 10 11 12
a Empty AZ505 (ditrifluoroacetate) RX-3117 Mavoglurant Mavoglurant (racemate) XL413 (hydrochloride) WAY-600 Vesnarinone Grazoprevir Grazoprevir potassium salt Grazoprevir hydrate Empty
b Empty Skepinone-L CC0651 Avermectin B1a CBB1007 (trihydrochloride) Ranirestat AMG 487 AMG 487 (S-enantiomer) NBI-74330 Trovirdine ALK inhibitor 1 Empty
c Empty Episilvestrol Glyparamide Lucitanib Chroman 1 Atrasentan (hydrochloride) PF-543 (Citrate) PF-04957325 GDC-0834 GDC-0834 (Racemate) GDC-0834 (S-enantiomer) Empty
d Empty Encenicline hydrochloride Quisinostat NG25 Temsavir Fostemsavir Basimglurant Selisistat S-enantiomer Selisistat R-enantiomer CHIR-090 SRT3109 Empty
e Empty KN-93 KN-93 (hydrochloride) KN-93 (phosphate) NSC 42834 Tanzisertib AZD7687 RGB-286638 (free base) TAK-593 OTSSP167 (hydrochloride) Merestinib dihydrochloride Empty
f Empty SEA0400 KN-92 (phosphate) KN-92 (hydrochloride) PSI-697 SCH900776 SCH900776 (S-isomer) LY 3000328 Cebranopadol Cebranopadol ((1α,4α)stereoisomer) Tilbroquinol Empty
g Empty Metiamide Zaltidine FRAX597 EPZ005687 HOE-S 785026 (trihydrochloride) APD597 VcMMAE McMMAF MMAF (Hydrochloride) D8-MMAF (hydrochloride) Empty
h Empty MMAD D8-MMAD Auristatin E Auristatin F Taltobulin (trifluoroacetate) TMC647055 (Choline salt) Phen-DC3 Trifluoromethanesulfonate 360A (iodide) UPF-648 Encorafenib Empty

Plate layout: HY-L001P-Part C-12

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Tanaproget WEHI-539 hydrochloride JNK-IN-7 Hoechst S 769121 Hoechst 33258 analog HOE 32020 Hoechst 33342 analog 2 (trihydrochloride) para-iodoHoechst 33258 TD-198946 Filorexant Empty
b Empty INT-777 INT-777 (R-enantiomer) PI4KIII beta inhibitor 3 O-Propargyl-Puromycin Senexin A Ripasudil SMIP004 TUG-770 SAR7334 SAR7334 (hydrochloride) Empty
c Empty LY2795050 AL 082D06 NMS-859 Istaroxime (hydrochloride) H-1152 (dihydrochloride) Vercirnon CDDO-Im Lucidin c-Met inhibitor 1 DB07268 Empty
d Empty Mc-MMAD Mc-MMAE Vc-MMAD PSI-7409 tetrasodium Deltarasin Deltarasin (hydrochloride) JNJ-40411813 GNE-617 GNE-617 (hydrochloride) WHI-P180 Empty
e Empty TR-14035 Arginase inhibitor 1 HG-9-91-01 AVE 0991 AVE 0991 (sodium salt) Morinidazole Morinidazole (R enantiomer) Elbasvir NBI-98782 Nemorubicin Empty
f Empty GNE0877 AZD1283 HG-14-10-04 CAY10566 CUDC-427 YLF-466D MIR96-IN-1 Revefenacin MK-7246 AP-III-a4 (hydrochloride) Empty
g Empty GGTI298 Trifluoroacetate Clopidogrel thiolactone GSK2838232 GW311616 BQ-788 (sodium salt) Aprocitentan AMPPD Ravoxertinib Ravoxertinib hydrochloride Kif15-IN-1 Empty
h Empty Kif15-IN-2 NVP-CGM097 NVP-CGM097 (stereoisomer) NVP-CGM097 (sulfate) CPI-360 CPI-169 Savolitinib Antitumor Compound 1 GSK2110183 (hydrochloride) Omarigliptin Empty

Plate layout: HY-L001P-Part C-13

1 2 3 4 5 6 7 8 9 10 11 12
a Empty VER-50589 VER-49009 SM-164 Hydrochloride Tenapanor BIBF 1202 Seviteronel Seviteronel (R enantiomer) Seviteronel (racemate) A-385358 ACTB-1003 Empty
b Empty AP1903 Arglabin BIX 02565 Talazoparib Talazoparib (8R,9S) BMS-214662 BNC105 CAL-130 (Hydrochloride) Celgosivir (hydrochloride) D-3263 (hydrochloride) Empty
c Empty Degarelix EL-102 FGH10019 Forodesine (hydrochloride) IMIRESTAT Osilodrostat Pradigastat MB05032 NB-598 (Maleate) Omtriptolide Empty
d Empty Briciclib PCI-27483 R112 CDK9-IN-2 Squalamine lactate Squalamine Relugolix Temoporfin Treprostinil (sodium) Upamostat Empty
e Empty VAL-083 Voreloxin (Hydrochloride) Narciclasine Deferasirox (Fe3+ chelate) Oligomycin A X-376 GSK2330672 TAPI-1 Z-VAD(OMe)-FMK Mcl1-IN-1 Empty
f Empty 7-Epi-docetaxel Helioxanthin derivative 5-4-2 Helioxanthin 8-1 AGN 194310 AGN 195183 α-Tocopherol (phosphate) BAMB-4 kb-NB77-78 Nexturastat A PNU-159682 Empty
g Empty Z-Ile-Glu-Pro-Phe-Ome USP7-IN-1 Basmisanil Lemborexant Presatovir Rapastinel Trifluoroacetate Tradipitant Amiselimod (hydrochloride) Avoralstat Eleclazine (hydrochloride) Empty
h Empty Gepotidacin Gepotidacin (S enantiomer) Ibiglustat Ralinepag Relebactam Ridinilazole Seletalisib Trofinetide Asapiprant Doravirine Empty

Plate layout: HY-L001P-Part C-14

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Vericiguat Veledimex Veledimex (S enantiomer) ND-630 ND-630 S enantiomer PKC-IN-1 RI-2 AFN-1252 SP-420 MI-503 Empty
b Empty Mavatrep ISA-2011B ARV-825 GW627368 SBI-0206965 Dihexa GDC-0339 IDO-IN-3 SR9011 W-54011 Empty
c Empty Itacitinib Itacitinib adipate RO8994 SBE-β-CD Nepafenac D5 Vicriviroc (maleate) Icatibant Azilsartan (medoxomil monopotassium) Sancycline Pyraclonil Empty
d Empty Haloxon HBX 19818 Cysteine Protease inhibitor Cysteine Protease inhibitor (hydrochloride) PLpro inhibitor Heparin Lithium salt Satraplatin Pneumocandin B0 Linaclotide Dalbavancin Empty
e Empty Solithromycin Amcasertib Bictegravir Cenobamate Cenobamate S-Enantiomer Evocalcet Pemafibrate Sacubitrilat Sparsentan Acebilustat Empty
f Empty Cefiderocol Edasalonexent Edonerpic maleate tarloxotinib bromide Glecaprevir Leniolisib Nicodicosapent Tenalisib Verdiperstat Zoliflodacin Empty
g Empty ALW-II-41-27 PCI 29732 RN486 LPA2 antagonist 1 S1RA (hydrochloride) GLPG0492 GLPG0492 (R enantiomer) JNJ-42153605 MUT056399 Prexasertib Empty
h Empty Prexasertib (dihydrochloride) Walrycin B B-Raf IN 1 KX1-004 Ombrabulin (hydrochloride) CaMKII-IN-1 AZ876 AKT-IN-1 AMG-47a SB 242235 Empty

Plate layout: HY-L001P-Part C-15

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Amitifadine (hydrochloride) mTOR-IN-1 UNC1079 5S rRNA modificator AA26-9 TMPA NSC-41589 Chitinase-IN-1 Chitinase-IN-2 Chitinase-IN-2 (hydrochloride) Empty
b Empty (±)-BI-D FIIN-3 K-Ras G12C-IN-1 K-Ras G12C-IN-3 CAY10603 DZ2002 OTS514 VI 16832 2,4-Pyrimidinediamine with linker LEQ506 Empty
c Empty Galidesivir (hydrochloride) ADX88178 NVP-HDM201 NVP-HDM201 R Enantiomer LTV-1 Integrin Antagonists 27 HQ-415 K-Ras-IN-1 OSU-T315 SIBA Empty
d Empty Dextrorotation nimorazole phosphate ester Mutant IDH1-IN-2 Endoxifen (Z-isomer hydrochloride) Endoxifen (E-isomer) Phorbol 12-myristate 13-acetate FLT3-IN-2 IDO-IN-4 IDO-IN-6 Navoximod IDO-IN-8 Empty
e Empty A2AR-agonist-1 PF-4840154 RR6 cFMS-IN-2 p38-α MAPK-IN-1 NU6300 NSC305787 (hydrochloride) DEL-22379 HDAC6-IN-1 GSK2795039 Empty
f Empty BGB-283 CCG215022 PLX7904 Vatinoxan hydrochloride TCV-309 (chloride) PF-06282999 PIM-447 (dihydrochloride) (1S,3R,5R)-PIM447 (dihydrochloride) EPZ031686 SU1498 Empty
g Empty ACY-775 ORM-15341 Tenovin-3 Aglafoline Rocaglamide AZD3264 Ferroquine AB-MECA Nav1.7-IN-2 L-685458 Empty
h Empty NAMI-A DPC-681 AZD9056 (hydrochloride) Esonarimod CYR-101 Topilutamide Ribocil Ribocil-C R enantiomer Ro 46-2005 PF-2771 Empty

Plate layout: HY-L001P-Part C-16

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Nemiralisib FRAX1036 I-CBP112 JAK3-IN-1 (+)-SJ733 SBI-0640756 Upadacitinib Calicheamicin DDP-38003 (trihydrochloride) LMI070 Empty
b Empty THS-044 NS-018 (maleate) NS-018 NS-018 (hydrochloride) Fezolinetant G-5555 G-5555 (hydrochloride) Glesatinib (hydrochloride) Tecadenoson PKR-IN-2 Empty
c Empty PF-3893787 hydrochloride ARS-853 KIRA6 MKC3946 STING agonist-1 DCVC Miransertib Emixustat Emixustat (hydrochloride) ABT-639 Empty
d Empty BIA 10-2474 Lp-PLA2 -IN-1 Sirtuin modulator 1 BET-IN-1 RIP2 kinase inhibitor 2 SCD inhibitor 1 PI3Kα inhibitor 1 RIP2 kinase inhibitor 1 Danirixin GSK2981278 Empty
e Empty amyloid P-IN-1 HDAC-IN-3 beta-lactamase-IN-1 3α-Aminocholestane (R)-BPO-27 BPO-27 (racemate) MP-A08 PI4KIIIbeta-IN-9 Naquotinib (mesylate) Photo-lysine (hydrochloride) Empty
f Empty MI-463 MI-538 Fmoc-Val-Cit-PAB-MMAE Acetylene-linker-Val-Cit-PABC-MMAE Elacestrant (dihydrochloride) AN3199 AZD-5069 Setmelanotide Lusutrombopag F 16915 Empty
g Empty ITX5061 Acoziborole MK-1064 Vaborbactam COH29 Saroglitazar Saroglitazar Magnesium DAA-1106 Eptapirone Glucagon receptor antagonists-4 Empty
h Empty GI254023X KIN1408 GDC-0084 TAK-220 Derazantinib CCT-251921 THZ1-R CRAC intermediate 1 ICA Cot inhibitor-1 Empty

Plate layout: HY-L001P-Part C-17

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Cot inhibitor-2 Triptolide (3S,4S)-Tofacitinib Ca2+ channel agonist 1 GPR120 modulator 1 GPR120 modulator 2 MK 0893 MK-0812 (Succinate) INCB3344 INCB3344 R-isomer Empty
b Empty MK-2461 Fiacitabine DUBs-IN-1 DUBs-IN-3 DUBs-IN-2 LY-411575 (isomer 1) LY-411575 (isomer 2) LY-411575 (isomer 3) gamma-secretase modulator 2 VTP-27999 (2,2,2-trifluoroacetate) Empty
c Empty SCH772984 Ruxolitinib (S enantiomer) Akt1 and Akt2-IN-1 PDE-9 inhibitor NVP-AEW541 BCX 1470 (methanesulfonate) ST 2825 Bay 65-1942 (hydrochloride) FMK p53 and MDM2 proteins-interaction-inhibitor (chiral) Empty
d Empty p53 and MDM2 proteins-interaction-inhibitor (dihydrochloride) Pevonedistat DMP 777 NBD-557 VTP-27999 (Hydrochloride) (+)-Cevimeline (hydrochloride hemihydrate) (-)-Cevimeline (hydrochloride hemihydrate) TAK1/MAP4K2 inhibitor 1 Calcitriol Impurities D Nucleoside-Analog-1 Empty
e Empty Nucleoside-Analog-2 4-(((2S,4S)-1-([1,1'-Biphenyl]-4-yl)-5-ethoxy-4-methyl-5-oxopentan-2-yl)amino)-4-oxobutanoic acid 2R,4R-Sacubitril 2R,4S-Sacubitril Mutated EGFR-IN-1 Pasireotide (ditrifluoroacetate) Pasireotide (L-aspartate salt) MMAF-OMe IDO-IN-1 BMX-IN-1 Empty
f Empty QL47 SJB3-019A Tildipirosin Iloprost Dalfopristin Pristinamycin IA Bimatoprost Enrofloxacin hydrochloride Travoprost Lubiprostone Empty
g Empty Ingenol Mebutate Hydroxyhexamide Taurocholic Acid (sodium hydrate) Glycerol NSC 601980 (analog) NSC 601980 Lucanthone 5-TAMRA-SE 6-TAMRA-SE 7ACC2 Empty
h Empty CY3-YNE CY5-YNE CY5 CY7-SE CY2-SE Imatinib metabolite N-Desmethyl Imatinib Niraparib metabolite M1 Sofosbuvir impurity F Sofosbuvir impurity G Sofosbuvir impurity I Empty

Plate layout: HY-L001P-Part C-18

1 2 3 4 5 6 7 8 9 10 11 12
a Empty Sofosbuvir impurity N Sofosbuvir impurity K Sofosbuvir impurity B Sofosbuvir impurity D Sofosbuvir impurity M Sofosbuvir impurity H Sofosbuvir impurity J Sofosbuvir impurity L Bergenin (+)-Catechin hydrate Empty
b Empty Hypericin Eriodictyol Isoorientin Isomangiferin Isosilybin Procyanidin B1 Procyanidin B2 Quillaic acid Bruceine A Bevirimat Empty
c Empty Micheliolide Sagittatoside A Ginkgetin 1-O-Acetylbritannilactone Ginsenoside Rg5 Desmethoxyyangonin Hexahydrocurcumin Cucurbitacin I Oleic acid Ganoderic acid A Empty
d Empty 14-Deoxy-11,12-didehydroandrographolide 4-Allylcatechol Phosphoramidon (Disodium) Withaferin A Fumitremorgin C Phorbol S-(+)-Marmesin Kainic acid Juglanin Eurycomanone Empty
e Empty Eledoisin Tos-Gly-Pro-Arg-ANBA-IPA (acetate) D-Lys(Z)-Pro-Arg-pNA (diacetate) pGlu-Pro-Arg-MNA (monoacetate) NIM811 Argipressin Lecirelin Nafarelin Teriparatide Vapreotide Empty
f Empty Vapreotide (acetate) GPRP (acetate) Cyclic somatostatin Porcine dynorphin A(1-13) Taspoglutide DAMGO A 779 GRGDSP (TFA) Sfllrnpndkyepf NGR peptide Trifluoroacetate Empty
g Empty Ac-Leu-Arg-AMC His-[D-2-ME-Trp]-Ala Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) Papain AZD2098 Triamcinolone hexacetonide Cimetropium (Bromide) Dixyrazine Datelliptium chloride ARS-1323 Empty
h Empty ARS-1630 ARS-1620 GNE 220 (Hydrochloride) CCG 203769 3BDO Ketohexokinase inhibitor 1 8-Hydroxy-2'-deoxyguanosine 3-Deazaadenosine (hydrochloride) JSH-150 (Z)2S,4R-Sacubitril Empty

Plate layout: HY-L001P-Part C-19

1 2 3 4 5 6 7 8 9 10 11 12
a Empty 2S,4R-Sacubitril Dehydronitrosonisoldipine Empty Empty Empty Empty Empty Empty Empty Empty Empty
b Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
c Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
d Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
e Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
f Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
g Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
h Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty Empty
Documentation

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Bioactive Compound Library Plus
Cat. No.:
HY-L001P
Quantity:

Request SDF File

Please enter your email address. We will send your requested SDF file to you as soon as possible.