2. GPCR/G Protein
  3. CRFR
  4. [DPro5] Corticotropin Releasing Factor, human, rat TFA

[DPro5] Corticotropin Releasing Factor, human, rat TFA 

Cat. No.: HY-P3684A Purity: 99.71%
COA Handling Instructions

Molarity Calculator

[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

[DPro5] Corticotropin Releasing Factor, human, rat TFA Chemical Structure

[DPro5] Corticotropin Releasing Factor, human, rat TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 190 In-stock
5 mg USD 490 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of [DPro5] Corticotropin Releasing Factor, human, rat TFA:

[DPro5] Corticotropin Releasing Factor, human, rat TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat[1].

In Vitro

[DPro5] Corticotropin Releasing Factor, human, rat TFA (1 nM; 1 h) diminishes the amplitude of hippocampal population spike and prevents the onset of long-term potentiation (LTP)[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

[DPro5] Corticotropin Releasing Factor, human, rat TFA Related Antibodies
In Vivo

[DPro5] Corticotropin Releasing Factor, human, rat TFA (0.01-1 μg; i.c.v.; single dose) doesn’t induce the typical anxiogenic effect, but produces a nonspecific suppression of behavior in Sprague-Dowley rats. And [DPro5] Corticotropin Releasing Factor, human, rat TFA also enhances the short-term memory to a maximum degree and prevented the memory loss induced by diazepam[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague-Dowley rats[1]
Dosage: 0.01-1 μg
Administration: Intracerebroventricular injection; single dose
Result: Decreased the number of visits into the light box in the dark-light test.
Molecular Weight

4757.45 (free base)

Formula

C208H344N60O63S2.xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Ser-Glu-Glu-Pro-{d-Pro}-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Sequence Shortening

SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (Need ultrasonic)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

[DPro5] Corticotropin Releasing Factor, human, rat TFA Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

[DPro5] Corticotropin Releasing Factor, human, ratCRFRCorticotropin-releasing Factor ReceptorCRHRInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
[DPro5] Corticotropin Releasing Factor, human, rat TFA
Cat. No.:
HY-P3684A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.