[DPro5] Corticotropin Releasing Factor, human, rat TFA
Based on 1 Customer Validation
[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.
For research use only. We do not sell to patients.
- Purity : 98.71%
- Formula: C208H344N60O63S2.xC2HF3O2
- Molecular Weight:4757.45 (free base)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biological Activity
Description
In Vitro
[DPro5] Corticotropin Releasing Factor, human, rat TFA (1 nM; 1 h) diminishes the amplitude of hippocampal population spike and prevents the onset of long-term potentiation (LTP)[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dowley rats[1]
-
Dosage:0.01-1 μg
-
Administration:Intracerebroventricular injection; single dose
-
Result:Decreased the number of visits into the light box in the dark-light test.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4757.45 (free base)
-
Formula C208H344N60O63S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Ser-Glu-Glu-Pro-{d-Pro}-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
-
Sequence Shortening
SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvent & Solubility
In Vitro:
H2O : 50 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Shabanov PD, et al. [Anxiogenic and mnestic effects of corticoliberin and its analogs introduced into the brain ventriculi of rats]. Eksp Klin Farmakol. 2006 Nov-Dec;69(6):3-8. Russian. [Content Brief]
[2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)