1. GPCR/G Protein
  2. CRFR
  3. [DPro5] Corticotropin Releasing Factor, human, rat

[DPro5] Corticotropin Releasing Factor, human, rat 

Cat. No.: HY-P3684
Handling Instructions

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

[DPro5] Corticotropin Releasing Factor, human, rat Chemical Structure

[DPro5] Corticotropin Releasing Factor, human, rat Chemical Structure

CAS No. : 195628-97-8

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of [DPro5] Corticotropin Releasing Factor, human, rat:

Other Forms of [DPro5] Corticotropin Releasing Factor, human, rat:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat[1].

In Vitro

[DPro5] Corticotropin Releasing Factor, human, rat (1 nM; 1 h) diminishes the amplitude of hippocampal population spike and prevents the onset of long-term potentiation (LTP)[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

[DPro5] Corticotropin Releasing Factor, human, rat (0.01-1 μg; i.c.v.; single dose) doesn’t induce the typical anxiogenic effect, but produces a nonspecific suppression of behavior in Sprague-Dowley rats. And [DPro5] Corticotropin Releasing Factor, human, rat also enhances the short-term memory to a maximum degree and prevented the memory loss induced by diazepam[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague-Dowley rats[1]
Dosage: 0.01-1 μg
Administration: Intracerebroventricular injection; single dose
Result: Decreased the number of visits into the light box in the dark-light test.
Molecular Weight

4757.45

Formula

C208H344N60O63S2

CAS No.
Sequence Shortening

SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

[DPro5] Corticotropin Releasing Factor, human, rat Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
[DPro5] Corticotropin Releasing Factor, human, rat
Cat. No.:
HY-P3684
Quantity:
MCE Japan Authorized Agent: