[DPro5] Corticotropin Releasing Factor, human, rat
[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.
For research use only. We do not sell to patients.
- CAS No.: 195628-97-8
- Formula: C208H344N60O63S2
- Molecular Weight:4757.45
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
![[DPro5] Corticotropin Releasing Factor, human, rat Chemical Structure](https://file.medchemexpress.com/product_pic/hy-p3684.gif "Click to View [DPro5] Corticotropin Releasing Factor, human, rat Chemical Structure")
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
[DPro5] Corticotropin Releasing Factor, human, rat (1 nM; 1 h) diminishes the amplitude of hippocampal population spike and prevents the onset of long-term potentiation (LTP)[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dowley rats[1]
-
Dosage:0.01-1 μg
-
Administration:Intracerebroventricular injection; single dose
-
Result:Decreased the number of visits into the light box in the dark-light test.
Chemical Information
-
CAS No. 195628-97-8
-
Molecular Weight 4757.45
-
Formula C208H344N60O63S2
-
Sequence Shortening
SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Shabanov PD, et al. [Anxiogenic and mnestic effects of corticoliberin and its analogs introduced into the brain ventriculi of rats]. Eksp Klin Farmakol. 2006 Nov-Dec;69(6):3-8. Russian. [Content Brief]
[2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
[DPro5] Corticotropin Releasing Factor, human, rat Related Classifications
HY-P3684 Related Classifications
Powered by Bioz