1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-10
  5. IL-10 Protein, Human (CHO)

IL-10 Protein, Human (CHO)

Cat. No.: HY-P7030A
COA Handling Instructions

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $57 In-stock
10 μg $160 In-stock
50 μg $560 In-stock
100 μg $950 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Background

Interleukin 10 (IL-10) is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation. A promising alternative is interleukin 10 (IL-10), a cytokine with multiple anti-inflammatory and immunoregulatory activities, including inhibition of T-cell/macrophage activation and proinflammatory cytokine synthesis[1]. IL-10, a cytokine possessing strong anti-inflammatory properties, is under investigation for its therapeutic use as an immunosuppressant. The immunosuppressive actions of IL-10 and corticosteroids include inhibition of proinflammatory cytokine production by monocytes and polymorphonuclear leukocytes (IFN-γ, TNF-α, IL-1β, IL-6, GM-CSF) both at the protein and messenger RNA levels and prevention of mitogen-induced T-cell proliferation[2].

Biological Activity

1.The ED50 is <0.2 ng/mL as measured by MC/9 cells.
2.Immobilized human IL10 at 10 μg/mL (100 μl/well) can bind Cynomolgus IL10RA. The ED50 for this effect is 1.732 μg/mL.

  • Immobilized human IL10 at 10 μg/mL (100 μL/well) can bind Cynomolgus IL10RA,The ED50 for this effect is 1.732 μg/mL.
Species

Human

Source

CHO

Tag

Tag Free

Accession

P22301 (S19-N178)

Gene ID
Molecular Construction
N-term
IL-10 (S19-N178)
Accession # P22301
C-term
Synonyms
rHuIL-10; CSIF
AA Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Weight

18-19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-10 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10 Protein, Human (CHO)
Cat. No.:
HY-P7030A
Quantity:
MCE Japan Authorized Agent: