1. Recombinant Proteins
  2. Others
  3. VIP Protein, Human (HEK293, His)

VIP Protein, Human (HEK293, His)

Cat. No.: HY-P71061
COA Handling Instructions

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VIP Protein, Human (HEK293, His) is 132 a.a., with molecular weight of 17-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $96 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE VIP Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VIP Protein, Human (HEK293, His) is 132 a.a., with molecular weight of 17-35 kDa.

Background

VIP, a neuropeptide with diverse physiological effects, elicits vasodilation, contributing to the lowering of arterial blood pressure. It further stimulates myocardial contractility, enhances glycogenolysis, and induces relaxation in the smooth muscles of the trachea, stomach, and gall bladder. In addition to VIP, both PHM and PHV also display vasodilatory properties. Notably, PHM-27 emerges as a potent agonist of the calcitonin receptor CALCR, demonstrating efficacy comparable to that of calcitonin. These findings highlight the multifaceted actions of VIP and its related peptides in regulating cardiovascular functions and smooth muscle activity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01282-2 (S21-G152)

Gene ID
Molecular Construction
N-term
VIP (S21-G152)
Accession # P01282-2
6*His
C-term
Synonyms
Vasoactive intestinal peptide; VIP; Intestinal peptide PHV-42; Peptide histidine methioninamide 27; Vasoactive intestinal polypeptide
AA Sequence

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

Molecular Weight

Approximately 17-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VIP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VIP Protein, Human (HEK293, His)
Cat. No.:
HY-P71061
Quantity:
MCE Japan Authorized Agent: