Copy Link Print Information

VIP Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VIP Protein, Human (HEK293, His)
  • Experimental Validation Results for VIP Protein, Human (HEK293, His)
  • VIP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VIP is a neuropeptide that induces vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, enhances glycogenolysis, and relaxes tracheal, gastric, and gallbladder smooth muscles. PHM and PHV-related peptides also have vasodilatory properties. VIP Protein, Human (HEK293, His) is the recombinant human-derived VIP protein, expressed by HEK293 , with C-6*His labeled tag.

Background

VIP, a neuropeptide with diverse physiological effects, elicits vasodilation, contributing to the lowering of arterial blood pressure. It further stimulates myocardial contractility, enhances glycogenolysis, and induces relaxation in the smooth muscles of the trachea, stomach, and gall bladder. In addition to VIP, both PHM and PHV also display vasodilatory properties. Notably, PHM-27 emerges as a potent agonist of the calcitonin receptor CALCR, demonstrating efficacy comparable to that of calcitonin. These findings highlight the multifaceted actions of VIP and its related peptides in regulating cardiovascular functions and smooth muscle activity.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P01282-2 (S21-G152)

  • Gene ID
    7432  [NCBI]
  • Molecular Construction
    • N-term
    • VIP (S21-G152)
      Accession # P01282-2
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    VIP; VIP peptides; Intestinal peptide PHV-42; Peptide histidine valine 42; PHV-42; Intestinal peptide PHM-27; Peptide histidine methioninamide 27; PHM-27; Vasoactive intestinal peptide; Vasoactive intestinal polypeptide; Vasoactive Intestinal Peptide; Pre

  • AA Sequence

    SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNG

  • Predicted Molecular Mass

    15.9 kDa

  • Molecular Weight

    Approximately 17-35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    VIP Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Ageing Res Rev. 2022 Nov:81:101733. [Abstract]

    Customer Validation
     After seeding of human NP cells onto 96-well plate, VIP Protein, Human (HEK293, His) with different concentrations was used to treat NP cells for 24 h. Then, the effect of VIP on cell viability of NP cells was evaluated using cell counting kit-8.

  • VIP Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for VIP Protein, Human (HEK293, His)
  • Experimental Validation Results for VIP Protein, Human (HEK293, His)
  • VIP Protein, Human (HEK293, His) Product Image

  • VIP Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Ageing Res Rev. 2022 Nov:81:101733. [Abstract]

    After seeding of human NP cells onto 96-well plate, VIP Protein, Human (HEK293, His) with different concentrations was used to treat NP cells for 24 h. Then, the effect of VIP on cell viability of NP cells was evaluated using cell counting kit-8.