ACPS Protein, Streptococcus pyogenes serotype M28 (sf9, His-Myc)
ACPS Protein, Streptococcus pyogenes serotype M28 (sf9, His-Myc), a 4-phosphopantetheinyl transferase, activates two distinct acyl carrier proteins (ACPs) that are present in fatty acid synthase (FAS) systems FAS-I and FAS-II, the ACP-I domain and the mycobacterial ACP-II protein (ACPM), respectively.
- Species: Others
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ACPS Protein, Streptococcus pyogenes serotype M28 (sf9, His-Myc), a 4-phosphopantetheinyl transferase, activates two distinct acyl carrier proteins (ACPs) that are present in fatty acid synthase (FAS) systems FAS-I and FAS-II, the ACP-I domain and the mycobacterial ACP-II protein (ACPM), respectively[1].
Background
Acyl carrier protein synthases (AcpSs), which are about 120 amino acid residues in length, and display a biologically active trimeric arrangement of α/β fold. A structure-based sequence comparison between AcpS and its ACP substrates from various species demonstrated that the proteins of the Corynebacterineae family display high sequence conservation, forming a segregated subgroup of AcpS and ACPs. Sequence-based structure analysis of AcpS and its ACP substrates from different species revealed that for the Corynebacterineae family of bacteria, AcpS, ACP-I, and ACPM each display high sequence conservation that sets them apart from other bacteria, fungi, and parasites[1].
Technical Parameters
-
Species Others
-
Source Sf9 insect cells
-
Tag N-10*His;C-Myc
-
Accession
Q48RM7 (M1-K118)
-
Gene ID/
-
Molecular Construction
-
N-term
-
10*His
-
ACPS (M1-K118)
Accession # Q48RM7 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
AASDHPPT; LYS5; Aminoadipate-Semialdehyde Dehydrogenase-Phosphopantetheinyl Transferase; ACPS; AASD-PPT; Holo-[Acyl-Carrier-Protein] Synthase; Alpha-Aminoadipic Semialdehyde Dehydrogenase-Phosphopantetheinyl Transferase; Holo ACP Synthase; L-Aminoadipate-
-
AA Sequence
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
-
Predicted Molecular Mass
17.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
