ADTRP Protein, Human (Cell-Free, His, Myc)
ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADTRP protein exhibits specialized enzymatic activity, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for branched FAHFAs. This unique function distinguishes ADTRP, as it does not hydrolyze other major lipid classes. Moreover, ADTRP regulates endothelial cells, influencing TFPI expression and cell-associated anticoagulant activity, observed in in vitro settings. ADTRP Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived ADTRP protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag.
Background
ADTRP protein demonstrates a specialized enzymatic function, specifically hydrolyzing bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), with a notable preference for FAHFAs exhibiting branching distal from the carboxylate head group. This distinctive enzymatic activity sets ADTRP apart, as it does not hydrolyze other major classes of lipids. Additionally, ADTRP plays a regulatory role in endothelial cells by influencing the expression and cell-associated anticoagulant activity of the inhibitor TFPI, as observed in in vitro settings.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His;C-Myc
-
Accession
Q96IZ2 (M1-K230)
-
Gene ID84830
-
Molecular Construction
-
N-term
-
10*His
-
ADTRP (M1-K230)
Accession # Q96IZ2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ADTRP; Fatty Acid Esters Of Hydroxy Fatty Acids Hydrolase ADTRP; Prev. C6orf105; Androgen-Dependent TPF1-Regulating Protein; Androgen-Dependent TFPI-Regulating Protein; Chromosome 6 Open Reading Frame 105; DJ413H6.1; Androgen-Induced 1-Like; AIG1L; Androg
-
AA Sequence
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
-
Predicted Molecular Mass
31.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
