AG-2 Protein, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

AG-2 Protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus. It is believed to have a significant role in the production of mucus by intestinal cells. Additionally, AG-2 is considered a proto-oncogene that potentially influences cell migration, cell differentiation, and cell growth. It also promotes cell adhesion. AG-2 exists as both a monomer and homodimer. Furthermore, it interacts with LYPD3 and DAG1 (alphaDAG1) proteins, and forms a disulfide-linked interaction with MUC2.

Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 0.9917 μg/mL, corresponding to a specific activity is 1008.370 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 0.9917 μg/mL, corresponding to a specific activity is 1008.370 units/mg.

Mouse

HEK293

C-His

O88312 (K21-L175)

23795  [NCBI]

Full Length of Mature Protein

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

approximately 20-22 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 1 mM TCEP, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.