1. Recombinant Proteins
  2. Others
  3. AIF1 Protein, Human (N-His)

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.

Background

AIF1, an actin-binding protein, serves as a facilitator of membrane ruffling and RAC activation, and augments the actin-bundling activity of LCP1. This calcium-binding protein plays a crucial role in RAC signaling, phagocytosis, and potentially contributes to macrophage activation and function. AIF1 is implicated in promoting the proliferation of vascular smooth muscle cells and T-lymphocytes, as well as enhancing lymphocyte migration. Additionally, it is involved in vascular inflammation. AIF1 can exist as a homodimer (Potential) or a monomer and interacts with LCP1, indicating its participation in intricate molecular interactions governing cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

P55008 (M1-P147)

Gene ID

199  [NCBI]

Molecular Construction
N-term
His
AIF1 (M1-P147)
Accession # P55008
C-term
Protein Length

Full Length

Synonyms
AIF-1; Allograft inflammatory factor 1
AA Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predicted Molecular Mass
18.8 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AIF1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AIF1 Protein, Human (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AIF1 Protein, Human (N-His)
Cat. No.:
HY-P7488A
Quantity:
MCE Japan Authorized Agent: