AIF1 Protein, Human (N-His)
Based on 1 Customer Validation
The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.
AIF1, an actin-binding protein, serves as a facilitator of membrane ruffling and RAC activation, and augments the actin-bundling activity of LCP1. This calcium-binding protein plays a crucial role in RAC signaling, phagocytosis, and potentially contributes to macrophage activation and function. AIF1 is implicated in promoting the proliferation of vascular smooth muscle cells and T-lymphocytes, as well as enhancing lymphocyte migration. Additionally, it is involved in vascular inflammation. AIF1 can exist as a homodimer (Potential) or a monomer and interacts with LCP1, indicating its participation in intricate molecular interactions governing cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P55008 (M1-P147)
-
Molecular Construction
-
N-term
-
His
-
AIF1 (M1-P147)
Accession # P55008 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AIF1; Interferon Gamma Responsive Transcript; Allograft Inflammatory Factor 1; Em:AF129756.17; AIF-1; Protein G1; IBA1; IRT1; Ionized Calcium-Binding Adapter Molecule 1; G1; IRT-1
-
AA Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
