1. Recombinant Proteins
  2. Angiopoietin-1 Protein, Human (HEK 293, Fc)

Angiopoietin-1 Protein, Human (HEK 293, Fc)

Cat. No.: HY-P70061
Handling Instructions

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a recombinant Angiopoietin-1 protein with a Fc-flag. Angiopoietin-1 Protein is a secretory ligand of tyrosine kinase that is mainly expressed by vascular endothelial cells and hematopoietic cells. Angiopoietin-1 (Ang1) is a potential growth factor for therapeutic angiogenesis and vascular stabilization[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $105 In-stock
Estimated Time of Arrival: December 31
50 μg $315 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuAngiopoietin-1/ANG1, Fc; AGP1; AGPT; Ang1; ANG-1; angiopoietin 1; Angiopoietin-1; ANGPT1
Species

Human

Source

HEK 293

Accession

Q15389 (D256-F498)

Gene ID

284

Molecular Weight

55-65 kDa

AA Sequence

DTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Purity

Greater than 95% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Angiopoietin-1is a secreted protein ligand for ‘tunica interna endothelial cell kinase. Angiopoietin-1 is primarily expressed in growing vascular ECs and a subset of hematopoietic cells. Ang 1 can induce distinctive vascularremodeling through highly organized angiogenesis and tightening of endothelial cell (EC) junctions[1].
The structure of Ang1 consists a carboxyl-terminal fibrinogen-like domain that can binds to the Tie2 receptor (a central coiled-coil domain).
Ang1 plays critical roles in vascular assembly, maturation and stabilization, coronary venogenesis and glomerular vascular protection during developmental and pathological angiogenesis[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-1 Protein, Human (HEK 293, Fc)
Cat. No.:
HY-P70061
Quantity:
MCE Japan Authorized Agent: