1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-1
  5. Angiopoietin-1 Protein, Human (HEK293, Fc)

Angiopoietin-1 Protein, Human (HEK293, Fc)

Cat. No.: HY-P70061
COA Handling Instructions

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a recombinant Angiopoietin-1 protein with a Fc-flag. Angiopoietin-1 Protein is a secretory ligand of tyrosine kinase that is mainly expressed by vascular endothelial cells and hematopoietic cells. Angiopoietin-1 (Ang1) is a potential growth factor for therapeutic angiogenesis and vascular stabilization.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $95 In-stock
50 μg $260 In-stock
100 μg $450 In-stock
500 μg $1350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Angiopoietin-1 Protein, Human (HEK 293, Fc) is a recombinant Angiopoietin-1 protein with a Fc-flag. Angiopoietin-1 Protein is a secretory ligand of tyrosine kinase that is mainly expressed by vascular endothelial cells and hematopoietic cells. Angiopoietin-1 (Ang1) is a potential growth factor for therapeutic angiogenesis and vascular stabilization[1][2].

Background

Angiopoietin-1is a secreted protein ligand for ‘tunica interna endothelial cell kinase. Angiopoietin-1 is primarily expressed in growing vascular ECs and a subset of hematopoietic cells. Ang 1 can induce distinctive vascularremodeling through highly organized angiogenesis and tightening of endothelial cell (EC) junctions[1].
The structure of Ang1 consists a carboxyl-terminal fibrinogen-like domain that can binds to the Tie2 receptor (a central coiled-coil domain).
Ang1 plays critical roles in vascular assembly, maturation and stabilization, coronary venogenesis and glomerular vascular protection during developmental and pathological angiogenesis[2].

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 356.9 ng/ml, corresponding to a specific activity is 2801.905 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 356.9 ng/ml, corresponding to a specific activity is 2801.905 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q15389 (D256-F498)

Gene ID

284  [NCBI]

Molecular Construction
N-term
hFc
Angiopoietin-1 (D256-F498)
Accession # Q15389
C-term
Synonyms
rHuAngiopoietin-1/ANG1, Fc; AGP1; AGPT; Ang1; ANG-1; angiopoietin 1; Angiopoietin-1; ANGPT1
AA Sequence

DTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Molecular Weight

Approximately 57.25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Angiopoietin-1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70061
Quantity:
MCE Japan Authorized Agent: