Angiopoietin-1 Protein, Mouse (HEK293, N-His)

Angiopoietin-1 (ANGPT1) is a secreted glycoprotein that belongs to the angiopoietin family. It actively regulates blood vessel formation and stabilization, playing a pivotal role in vascular development. ANGPT1 also influences skeletal myoblasts and orchestrates the vascular response to tissue injury. Its broad expression in various tissues highlights its significance in diverse physiological contexts. Angiopoietin-1 Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived Angiopoietin-1 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Angiopoietin-1 Protein, Mouse (HEK293, N-His) is 222 a.a., with molecular weight of ~29 kDa.

Angiopoietin-1 (ANGPT1) encodes a secreted glycoprotein within the angiopoietin family of vascular growth factors. As a crucial ligand in the vascular tyrosine kinase signaling pathway, this protein actively regulates the formation and stabilization of blood vessels, demonstrating its pivotal role in vascular development. Beyond its vascular functions, ANGPT1 operates in striated muscles, influencing the proliferation, migration, and differentiation of skeletal myoblasts. Moreover, ANGPT1 plays a vital role in orchestrating the vascular response to tissue injury. The gene exhibits alternative splicing, resulting in multiple transcript variants. Its broad expression across various tissues, including the heart, lung, and other anatomical sites, underscores the significance of ANGPT1 in diverse physiological contexts.

Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×10^3 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 223.9 ng/mL, corresponding to a specific activity is 4.466×10³ units/mg.

Mouse

HEK293

N-6*His

NP_033770.2 (R277-F498)

11600

REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Approximately 29 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.