ANGPT2/Angiopoietin-2, Dog (HEK293, His)

ANGPT2/Angiopoietin-2, Dog, intricately modulates angiogenesis by binding to TEK/TIE2, competitively impacting ANGPT1 signaling. It induces TEK/TIE2 phosphorylation independently and, in the absence of VEGF, may lead to endothelial apoptosis, contributing to vascular regression. Collaborating with VEGF, ANGPT2 facilitates angiogenesis, promoting endothelial cell migration and proliferation. Additionally, ANGPT2 regulates lymphangiogenesis, emphasizing its comprehensive role in vascular dynamics within dog biology. Its interactions with TEK/TIE2 and ITGA5 highlight its multifaceted contribution to angiogenesis and vascular regulation. ANGPT2/Angiopoietin-2, Dog (HEK293, His) is the recombinant dog-derived ANGPT2/Angiopoietin-2, Dog, expressed by HEK293, with C-6*His labeled tag. The total length of ANGPT2/Angiopoietin-2, Dog (HEK293, His) is 477 a.a., with molecular weight of 57.2 kDa.

The Dog Angiopoietin-2 protein (ANGPT2) engages in a multifaceted role as it binds to TEK/TIE2, competing for the ANGPT1 binding site and effectively modulating ANGPT1 signaling. Notably, ANGPT2 has the capacity to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. Its function extends to angiogenesis regulation, where in the absence of angiogenic inducers like VEGF, ANGPT2-mediated loosening of cell-matrix contacts may lead to endothelial cell apoptosis, contributing to vascular regression. Conversely, in collaboration with VEGF, ANGPT2 can facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is implicated in the regulation of lymphangiogenesis. The protein's interactions with TEK/TIE2, competing for the same binding site as ANGPT1, and with ITGA5 underscore its comprehensive role in angiogenesis and vascular regulation within the context of dog biology.

Dog

HEK293

C-6*His

A0A8J8 (Y19-F495)

607616  [NCBI]

YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

57.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.