ANGPTL4/Angiopoietin-related 4 Protein, Mouse (HEK293, C-hFc)

Angiopoietin-related protein 4/ANGPTL4 Protein, Mouse (HEK293, Fc) expresses in HEK293 with an Fc fragment at the C-terminus. Angiopoietin-Related Protein 4 (ANGPTL4) is a multifunctional cytokine regulating vascular permeability, angiogenesis, and inflammation^[1].

Angiopoietin-Related Protein 4 (ANGPTL4) is a secreted protein and a member of a family of angiopoietin-like proteins (ANGPTL1-8)^[1].

Immobilized Mouse ANGPTL4 at 1 μg/mL (100 μL/well) can bind Biotinylated Human ILT4 protein. The ED₅₀ for this effect is 0.8275 μg/mL.

• 
  Immobilized Mouse ANGPTL4 at 1 μg/mL (100 μL/well) can bind Biotinylated Human ILT4 protein. The ED₅₀ for this effect is 0.8275 μg/mL.

Mouse

HEK293

C-hFc

Q9Z1P8 (K167-S410)

57875

KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

56-67 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.