Animal-Free CXCL9 Protein, Pig (His)

CXCL9 Protein, part of the intercrine alpha family, is essential for chemokines crucial in intercellular communication and immune responses. Within this family, CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal specific functions and implications within the broader chemokine CxC family, emphasizing its significance in mediating immune responses while adhering to production methods. Animal-Free CXCL9 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL9 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free CXCL9 Protein, Pig (His) is 104 a.a., with molecular weight of ~12.88 kDa.

The CXCL9 protein is a member of the intercrine alpha (chemokine CxC) family, indicating its involvement in a group of chemokines crucial for intercellular communication and immune responses. Within the intercrine alpha family, CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal the specific functions and implications of this protein within the broader framework of the chemokine CxC family, underscoring its significance in mediating immune responses while adhering to production methods.

Pig

E. coli

N-His

B0FYK2 (T23-T126)

100135681  [NCBI]

TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT

Approximately 12.88 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.