Animal-Free Galectin-13 Protein, Human (His)
Based on 1 Customer Validation
Galectin-13 Protein, with beta-galactoside and lactose binding capacity, acts as a potent inducer of T-cell apoptosis, as confirmed by research findings. It also exhibits hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, maintained by disulfide linkages contributing to its dimeric form. Animal-Free Galectin-13 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-13 Protein, with beta-galactoside and lactose binding capacity, acts as a potent inducer of T-cell apoptosis, as confirmed by research findings. It also exhibits hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, maintained by disulfide linkages contributing to its dimeric form. Animal-Free Galectin-13 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background
The Galectin-13 Protein exhibits the capacity to bind to beta-galactoside and lactose, and it functions as a potent inducer of T-cell apoptosis, as supported by research findings. Additionally, this protein demonstrates hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, with disulfide linkages contributing to its dimeric form.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UHV8 (S2-N139)
-
Gene ID29124 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
Galectin-13 (S2-N139)
Accession # Q9UHV8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
LGALS13; Placental Protein 13; Galectin 13; Gal-13; PLAC8; Beta-Galactoside-Binding Lectin; PP13; Galectin-13; Lectin, Galactoside-Binding, Soluble, 13; Galectin; Galactoside-Binding Soluble Lectin 13; GAL13; Placental Tissue Protein 13
-
AA Sequence
SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
