Animal-Free IGF-II Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The IGF-II protein emerges as a key factor in glucose-mediated insulin secretion, co-secreted with insulin and functioning as a physiological amplifier for this process. Notably, IGF-II demonstrates osteogenic properties by enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3. This dual role underscores the protein's significance in both glucose homeostasis and bone metabolism, highlighting its potential therapeutic relevance in contexts related to insulin secretion and bone health.

Verified Bioactivity

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is >1.5 x 105 IU/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • IGF-II (A25-E91)
      Accession # P09535-1
    • C-term
  • Protein Length

    Full Length of IGF2 Chain

  • Synonyms

    IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734

  • AA Sequence

    AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Predicted Molecular Mass

    8.2 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00