1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. IGF family
  4. Insulin-like Growth Factor 2 (IGF-II)
  5. Animal-Free IGF-II Protein, Mouse (His)

Animal-Free IGF-II Protein, Mouse (His)

Cat. No.: HY-P700185AF
COA Handling Instructions

IGF-II Protein plays a crucial role in glucose-mediated insulin secretion, acting as a physiological amplifier alongside insulin. Additionally, it exhibits osteogenic properties by enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3. This dual functionality underscores the protein's importance in glucose homeostasis and bone metabolism, suggesting therapeutic relevance for insulin secretion and bone health contexts. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free IGF-II Protein, Mouse (His) is 67 a.a., with molecular weight of ~8.20 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $40 In-stock
10 μg $105 In-stock
50 μg $295 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGF-II Protein plays a crucial role in glucose-mediated insulin secretion, acting as a physiological amplifier alongside insulin. Additionally, it exhibits osteogenic properties by enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3. This dual functionality underscores the protein's importance in glucose homeostasis and bone metabolism, suggesting therapeutic relevance for insulin secretion and bone health contexts. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free IGF-II Protein, Mouse (His) is 67 a.a., with molecular weight of ~8.20 kDa.

Background

The IGF-II protein emerges as a key factor in glucose-mediated insulin secretion, co-secreted with insulin and functioning as a physiological amplifier for this process. Notably, IGF-II demonstrates osteogenic properties by enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3. This dual role underscores the protein's significance in both glucose homeostasis and bone metabolism, highlighting its potential therapeutic relevance in contexts related to insulin secretion and bone health.

Biological Activity

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is >1.5 x 105 IU/mg.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

D3Z4N4 (A25-E91)

Gene ID

16002

Molecular Construction
N-term
His
IGF-II (A25-E91)
Accession # D3Z4N4
C-term
Synonyms
AL033362; Igf; Igf-; Igf-2; M; M6; M6pr; Mpr; Peg; Peg2
AA Sequence

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Weight

Approximately 8.20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IGF-II Protein, Mouse (His)
Cat. No.:
HY-P700185AF
Quantity:
MCE Japan Authorized Agent: