1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO)

Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO)

Cat. No.: HY-P700253AF
SDS COA Handling Instructions Technical Support

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is the recombinant human-derived animal-FreeRSPO1/R-spondin-1 protein, expressed by HEK293 , with N-His, N-SUMO labeled tag. The total length of Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is 243 a.a., with molecular weight of ~65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is the recombinant human-derived animal-FreeRSPO1/R-spondin-1 protein, expressed by HEK293 , with N-His, N-SUMO labeled tag. The total length of Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) is 243 a.a., with molecular weight of ~65 kDa.

Background

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

Biological Activity

R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The ED50 for this effect is 1-3 μg/mL.

Species

Human

Source

HEK293

Tag

N-SUMO

Accession

Q2MKA7-1 (S21-A263)

Gene ID
Molecular Construction
N-term
SUMO
RSPO1 (S21-A263)
Accession # Q2MKA7-1
C-term
Synonyms
R-spondin-1; Roof plate-specific spondin-1; RSPO1
AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Molecular Weight

Approximately 65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free RSPO1/R-spondin-1 Protein, Human (243a.a, HEK293, His, SUMO)
Cat. No.:
HY-P700253AF
Quantity:
MCE Japan Authorized Agent: