2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3)
  5. Anionic trypsin-1 Protein, Rat (P.pastoris, His)

Anionic trypsin-1 Protein, Rat (P.pastoris, His)

Cat. No.: HY-P71772
Handling Instructions

Serine protease 1 is a member of the trypsin family of serine proteases. Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine. Anionic trypsin-1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of Anionic trypsin-1 Protein, Rat (P.pastoris, His) is 223 a.a., with molecular weight of ~23.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serine protease 1 is a member of the trypsin family of serine proteases. Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine. Anionic trypsin-1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of Anionic trypsin-1 Protein, Rat (P.pastoris, His) is 223 a.a., with molecular weight of ~23.1 kDa.
Background

Serine protease 1 is a member of the trypsin family of serine proteases. Serine protease 1 is secreted by the pancreas and cleaved to its active form in the small intestine. Serine protease 1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.
Species

Rat
Source

P. pastoris
Tag

N-His
Accession

P00762 ( 24I–246N)
Gene ID

24691  [NCBI]
Molecular Construction
N-term
His
Prss1 (24I–246N)
Accession # P00762
C-term
Synonyms
Prss1; Try1; Anionic trypsin-1; EC 3.4.21.4; Anionic trypsin I; Pretrypsinogen I; Serine protease 1
AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Molecular Weight

Approximately 23.1 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Anionic trypsin-1 Protein, Rat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Anionic trypsin-1 Protein, Rat (P.pastoris, His)
Cat. No.:
HY-P71772
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.