APCDD1 Protein, Human (466a.a, HEK293, Fc)

APCDD1 protein, a homodimer, negatively regulates the Wnt signaling pathway, acting cell-autonomously upstream of beta-catenin. Implicated in colorectal tumorigenesis, it interacts with LRP5 and WNT3A, suggesting involvement in complex interactions with Wnt and LRP proteins. APCDD1's pivotal role is evident in its contribution to intricate regulatory mechanisms governing Wnt signaling. APCDD1 Protein, Human (466a.a, HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293, with C-hFc labeled tag. The total length of APCDD1 Protein, Human (466a.a, HEK293, Fc) is 466 a.a., with molecular weight of 82-110 kDa.

APCDD1 protein operates as a negative regulator within the Wnt signaling pathway, exerting its inhibitory influence in a cell-autonomous manner and functioning upstream of beta-catenin. Its potential role in colorectal tumorigenesis suggests its significance in cellular processes associated with this condition. As a homodimer, APCDD1 interacts with LRP5 and WNT3A, indicating its involvement in complex interactions with Wnt and LRP proteins. These interactions collectively contribute to the intricate regulatory mechanisms that govern Wnt signaling, highlighting APCDD1's pivotal role in modulating this pathway.

Immobilized Human APCDD1, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Anti-APCDD1 Antibody, hFc Tag with the EC₅₀ of 17.8 ng/mL determined by ELISA.

Human

HEK293

C-hFc

Q8J025 (L27-H492)

147495

LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRH

82-110 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.