Copy Link Print Information

APCDD1 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The APCDD1 protein inhibits the Wnt signaling pathway and its mutations are associated with hereditary hypotrichosis simplex, causing hair loss. Increased expression of APCDD1 may be related to colorectal cancer development. The gene is highly expressed in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues. APCDD1 Protein, Human (HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for APCDD1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for APCDD1 Protein, Human (HEK293, Fc)
  • APCDD1 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The APCDD1 protein inhibits the Wnt signaling pathway and its mutations are associated with hereditary hypotrichosis simplex, causing hair loss. Increased expression of APCDD1 may be related to colorectal cancer development. The gene is highly expressed in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues. APCDD1 Protein, Human (HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The APCDD1 protein acts as an inhibitor of the Wnt signaling pathway. Mutations in this gene have been linked to hereditary hypotrichosis simplex, a condition characterized by hair loss. Additionally, overexpression of APCDD1 may be connected to the development of colorectal cancer. The gene exhibits biased expression in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues.

Verified Bioactivity

Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q8J025/NP_694545.1 (L27-G486)

  • Gene ID
    147495  [NCBI]
  • Molecular Construction
    • N-term
    • APCDD1 (L27-G486)
      Accession # Q8J025/NP_694545.1
    • hFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    APCDD1; Adenomatosis Polyposis Coli Down-Regulated 1; APC Down-Regulated 1; Hypoptrichosis Simplex; Protein APCDD1; FP7019; B7323; HYPT1; Adenomatosis Polyposis Coli Down-Regulated 1 Protein; HHS; DRAPC1; HTS

  • AA Sequence

    LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYG

  • Predicted Molecular Mass

    78.7 kDa

  • Molecular Weight

    Approximately 80-95 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL.

  • APCDD1 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for APCDD1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for APCDD1 Protein, Human (HEK293, Fc)
  • APCDD1 Protein, Human (HEK293, Fc) Product Image