APCDD1 Protein, Human (HEK293, Fc)

The APCDD1 protein inhibits the Wnt signaling pathway and its mutations are associated with hereditary hypotrichosis simplex, causing hair loss. Increased expression of APCDD1 may be related to colorectal cancer development. The gene is highly expressed in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues. APCDD1 Protein, Human (HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of APCDD1 Protein, Human (HEK293, Fc) is 460 a.a., with molecular weight of ~85.7 KDa.

The APCDD1 protein acts as an inhibitor of the Wnt signaling pathway. Mutations in this gene have been linked to hereditary hypotrichosis simplex, a condition characterized by hair loss. Additionally, overexpression of APCDD1 may be connected to the development of colorectal cancer. The gene exhibits biased expression in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues.

Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED50 for this effect is 148.7 ng/mL.

• 
  Immobilized APCDD1 at 1 μg/mL (100 μL/well) can bind Biotinylated Wnt-3a protein. The ED₅₀ for this effect is 148.7 ng/mL.

Human

HEK293

C-hFc

NP_694545.1 (L27-G486)

147495  [NCBI]

LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYG

Approximately 85.7 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.