APOC3 Protein, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of APOC3 Protein, Human (His-SUMO) is 79 a.a., with molecular weight of ~24.8 kDa.

APOC3 protein, a constituent of both triglyceride-rich very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL) in plasma, plays a multifaceted role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of hepatic very low-density lipoprotein 1 (VLDL1), contributing to lipid transport. Extracellularly, APOC3 serves to modulate the hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). This functionality involves inhibiting lipoprotein lipase and impeding the hepatic uptake of TRLs through remnant receptors. Structurally, APOC3 is characterized by several curved helices connected via semiflexible hinges, allowing it to tightly wrap around the curved micelle surface and adapt to the varying diameters of its natural binding partners. This structural flexibility underscores its versatile involvement in lipid metabolism and transport processes.

Human

E. coli

N-6*His;N-SUMO

P02656 (S21-A99)

345  [NCBI]

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Approximately 24.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.