APOD Protein, Human (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The IL-1RA/IL-1RN Protein operates as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. This protein serves as a crucial safeguard against immune dysregulation and uncontrolled systemic inflammation triggered by IL1, responding to various innate stimulatory agents, including pathogens. Its ability to modulate the inflammatory response highlights its significance in potential therapeutic interventions aimed at managing inflammatory disorders and maintaining immune balance. Shifting focus to the Alpha 1-Microglobulin Protein, it emerges as a multifunctional antioxidant and tissue repair agent, exhibiting reductase, heme-binding, and radical-scavenging activities. Operating in both intravascular and extravascular spaces, this protein plays a pivotal role in red cell homeostasis, protecting against heme-induced cell damage and mitigating oxidative stress. Its diverse functions span from preventing hemolysis in red blood cells to reducing extracellular methemoglobin and inhibiting oxidation of low-density lipoprotein particles during acute inflammation. Moreover, Alpha 1-Microglobulin safeguards against oxidation products in the extracellular matrix and cell membranes, contributing to cellular and extracellular matrix integrity. Within the intracellular milieu, it maintains mitochondrial redox homeostasis, offering protection against heme-induced oxidative damage and facilitating correct protein folding in the endoplasmic reticulum. Additionally, this protein exhibits antiprotease activity, inhibiting key proteases involved in inflammatory and cytotoxic responses, and plays a crucial role in extracellular matrix remodeling and cell adhesion.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APOD (Q21-S189)
      Accession # P05090
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOD; Apo-D; Apolipoprotein D; ApoD

  • AA Sequence

    QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

  • Predicted Molecular Mass

    19.3 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 o r20 mM PB, 150 mM NaCl, pH 7.2.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00