APOD Protein, Human (HEK293, C-His)
Based on 1 Customer Validation
APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
APOD Proteinas is an anti-inflammatory antagonist in the IL-1 family, targeting IL1B and IL1A to prevent immune dysregulation and systemic inflammation. Its ability to modulate inflammatory responses has important implications for potential therapeutic intervention in inflammatory diseases. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The IL-1RA/IL-1RN Protein operates as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. This protein serves as a crucial safeguard against immune dysregulation and uncontrolled systemic inflammation triggered by IL1, responding to various innate stimulatory agents, including pathogens. Its ability to modulate the inflammatory response highlights its significance in potential therapeutic interventions aimed at managing inflammatory disorders and maintaining immune balance. Shifting focus to the Alpha 1-Microglobulin Protein, it emerges as a multifunctional antioxidant and tissue repair agent, exhibiting reductase, heme-binding, and radical-scavenging activities. Operating in both intravascular and extravascular spaces, this protein plays a pivotal role in red cell homeostasis, protecting against heme-induced cell damage and mitigating oxidative stress. Its diverse functions span from preventing hemolysis in red blood cells to reducing extracellular methemoglobin and inhibiting oxidation of low-density lipoprotein particles during acute inflammation. Moreover, Alpha 1-Microglobulin safeguards against oxidation products in the extracellular matrix and cell membranes, contributing to cellular and extracellular matrix integrity. Within the intracellular milieu, it maintains mitochondrial redox homeostasis, offering protection against heme-induced oxidative damage and facilitating correct protein folding in the endoplasmic reticulum. Additionally, this protein exhibits antiprotease activity, inhibiting key proteases involved in inflammatory and cytotoxic responses, and plays a crucial role in extracellular matrix remodeling and cell adhesion.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P05090 (Q21-S189)
-
Molecular Construction
-
N-term
-
APOD (Q21-S189)
Accession # P05090 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOD; Apo-D; Apolipoprotein D; ApoD
-
AA Sequence
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS
-
Predicted Molecular Mass
19.3 kDa
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 o r20 mM PB, 150 mM NaCl, pH 7.2.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)