APOD Protein, Human (HEK293, C-His)

APOD Proteinas, an anti-inflammatory antagonist in the interleukin-1 family, targets IL1B and IL1A, safeguarding against immune dysregulation and systemic inflammation. Its ability to modulate the inflammatory response is significant for potential therapeutic interventions in inflammatory disorders. Alpha 1-Microglobulin Protein functions as a multifunctional antioxidant and tissue repair agent, playing pivotal roles in red cell homeostasis, oxidative stress mitigation, and cellular integrity. It exhibits antiprotease activity, inhibiting key proteases in inflammatory and cytotoxic responses, contributing to extracellular matrix remodeling and cell adhesion. APOD Protein, Human (HEK293, C-His) is the recombinant human-derived APOD protein, expressed by HEK293, with C-10*His labeled tag. The total length of APOD Protein, Human (HEK293, C-His) is 169 a.a., with molecular weight of 25-40 kDa.

The IL-1RA/IL-1RN Protein operates as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. This protein serves as a crucial safeguard against immune dysregulation and uncontrolled systemic inflammation triggered by IL1, responding to various innate stimulatory agents, including pathogens. Its ability to modulate the inflammatory response highlights its significance in potential therapeutic interventions aimed at managing inflammatory disorders and maintaining immune balance. Shifting focus to the Alpha 1-Microglobulin Protein, it emerges as a multifunctional antioxidant and tissue repair agent, exhibiting reductase, heme-binding, and radical-scavenging activities. Operating in both intravascular and extravascular spaces, this protein plays a pivotal role in red cell homeostasis, protecting against heme-induced cell damage and mitigating oxidative stress. Its diverse functions span from preventing hemolysis in red blood cells to reducing extracellular methemoglobin and inhibiting oxidation of low-density lipoprotein particles during acute inflammation. Moreover, Alpha 1-Microglobulin safeguards against oxidation products in the extracellular matrix and cell membranes, contributing to cellular and extracellular matrix integrity. Within the intracellular milieu, it maintains mitochondrial redox homeostasis, offering protection against heme-induced oxidative damage and facilitating correct protein folding in the endoplasmic reticulum. Additionally, this protein exhibits antiprotease activity, inhibiting key proteases involved in inflammatory and cytotoxic responses, and plays a crucial role in extracellular matrix remodeling and cell adhesion.

Data is not available.

Human

HEK293

C-10*His

P05090 (Q21-S189)

347  [NCBI]

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

25-40 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.