APOLD1 Protein, Human (Cell-Free, His)

The APOLD1 protein emerged as a potential regulator of angiogenesis, suggesting involvement in blood vessel formation. Its actions extend to activity-dependent changes in the cerebral vasculature, suggesting a dynamic function in regulating blood flow in neural tissue. APOLD1 Protein, Human (Cell-Free, His) is the recombinant human-derived APOLD1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of APOLD1 Protein, Human (Cell-Free, His) is 279 a.a., with molecular weight of 33.4 kDa.

APOLD1 Protein emerges as a potential participant in angiogenesis, suggesting a role in the intricate processes of blood vessel formation. Furthermore, it may contribute to activity-dependent changes in brain vasculature, hinting at a dynamic role in the modulation of blood flow within neural tissues. The potential impact of APOLD1 on blood-brain permeability implies its involvement in regulating the passage of substances between the bloodstream and the brain. Elucidating the specific mechanisms through which APOLD1 influences angiogenesis, activity-dependent alterations in brain vasculature, and blood-brain permeability could provide valuable insights into its role in vascular dynamics and potentially uncover new avenues for understanding and manipulating vascular processes in neurological contexts.

Human

E. coli Cell-free

N-10*His

Q96LR9 (M1-F279)

81575

MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF

33.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.