Copy Link Print Information

Apolipoprotein E/APOE Protein, Rat (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Apolipoprotein E/APOE Protein, Rat (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.

Background

APOE is a vital protein involved in the transportation of lipids between organs through plasma and interstitial fluids. It plays a crucial role in the production, conversion, and clearance of plasma lipoproteins. APOE interacts with various lipoprotein particles, such as chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. It also binds to numerous cellular receptors, including LDLR and VLDLR, facilitating the uptake of APOE-containing lipoproteins by cells. Additionally, APOE possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, which aids in the capture and receptor-mediated uptake of APOE-containing lipoproteins. Furthermore, APOE forms a homotetramer and may interact with ABCA1 in HDL biogenesis. It can also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, and with PMEL to induce fibril nucleation on intraluminal vesicles.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-6*His
  • Accession

    P02650 (E19-Q312)

  • Gene ID
    25728  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • APOE (E19-Q312)
      Accession # P02650
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5

  • AA Sequence

    EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ

  • Predicted Molecular Mass

    39.8 kDa

  • Molecular Weight

    Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Apolipoprotein E/APOE Protein, Rat (His) Product Image
    1/16
  • Apolipoprotein E/APOE Protein, Rat (His) Product Image