Apolipoprotein E/APOE Protein, Rat (His)

Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.

APOE is a vital protein involved in the transportation of lipids between organs through plasma and interstitial fluids. It plays a crucial role in the production, conversion, and clearance of plasma lipoproteins. APOE interacts with various lipoprotein particles, such as chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. It also binds to numerous cellular receptors, including LDLR and VLDLR, facilitating the uptake of APOE-containing lipoproteins by cells. Additionally, APOE possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, which aids in the capture and receptor-mediated uptake of APOE-containing lipoproteins. Furthermore, APOE forms a homotetramer and may interact with ABCA1 in HDL biogenesis. It can also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, and with PMEL to induce fibril nucleation on intraluminal vesicles.

Rat

E. coli

N-6*His

P02650 (E19-Q312)

25728  [NCBI]

Full Length of Mature Protein

EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ

45 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.