Apolipoprotein H/APOH Protein, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS)^[1].

Apolipoprotein H (ApoH), also known as β2-glycoprotein I (β2GPI), is a 43–50 kDa single-chain glycoprotein that is expressed predominantly in the liver but also in other cell types such as endothelial cells, lymphocytes, astrocytes and neurons. ApoH is a phospholipid-binding (e.g. cardiolipin) plasma protein that also binds other negatively charged molecules such as DNA and oxidised low-density lipoproteins and interacts with a variety of proteins^[1].

1.Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×10³ units/mg.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated Human LDL R (HY-P70235). The ED₅₀ for this effect is 0.3-0.8 μg/mL.

• 
  Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×10³ units/mg.
• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL(100 µL/well), can bind Biotinylated Recombinant Human LDL R (HY-P70235). The ED₅₀ for this effect is 0.5539 μg/mL.

Human

HEK293

C-His

P02749 (G20-C345)

350  [NCBI]

Full Length of Mature Protein

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Approximately 45-70 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.  [Content Brief]