Apolipoprotein H/APOH Protein, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS)^[1].

Apolipoprotein H (ApoH), also known as β2-glycoprotein I (β2GPI), is a 43–50 kDa single-chain glycoprotein that is expressed predominantly in the liver but also in other cell types such as endothelial cells, lymphocytes, astrocytes and neurons. ApoH is a phospholipid-binding (e.g. cardiolipin) plasma protein that also binds other negatively charged molecules such as DNA and oxidised low-density lipoproteins and interacts with a variety of proteins^[1].

Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×10³ units/mg.

• 
  Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×10³ units/mg.

Human

HEK293

C-His

P02749 (G20-C345)

350  [NCBI]

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPCHHHHHH

45-70 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.  [Content Brief]