Copy Link Print Information

Apolipoprotein H/APOH Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Apolipoprotein H/APOH Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS)[1].

Background

Apolipoprotein H (ApoH), also known as β2-glycoprotein I (β2GPI), is a 43–50 kDa single-chain glycoprotein that is expressed predominantly in the liver but also in other cell types such as endothelial cells, lymphocytes, astrocytes and neurons. ApoH is a phospholipid-binding (e.g. cardiolipin) plasma protein that also binds other negatively charged molecules such as DNA and oxidised low-density lipoproteins and interacts with a variety of proteins[1].

Verified Bioactivity

1.Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated Human LDL R (HY-P70235). The ED50 for this effect is 0.3-0.8 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL(100 µL/well), can bind Biotinylated Recombinant Human LDL R (HY-P70235). The ED50 for this effect is 0.5539 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    P02749 (G20-C345)

  • Gene ID
    350  [NCBI]
  • Molecular Construction
    • N-term
    • APOH (G20-C345)
      Accession # P02749
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOH; Anticardiolipin Cofactor; Prev. B2G1; Beta(2)GPI; Beta-2-Glycoprotein I; B2GPI; Beta-2-Glycoprotein 1; Apo-H; BG; Epididymis Secretory Sperm Binding Protein; Apolipoprotein H (Beta-2-Glycoprotein I); B2GP1; Activated Protein C-Binding Protein; Apoli

  • AA Sequence

    GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

  • Molecular Weight

    Approximately 45-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL(100 µL/well), can bind Biotinylated Recombinant Human LDL R (HY-P70235). The ED50 for this effect is 0.5539 μg/mL.

  • Apolipoprotein H/APOH Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Experimental Validation Results for Apolipoprotein H/APOH Protein, Human (HEK293, His)
  • Apolipoprotein H/APOH Protein, Human (HEK293, His) Product Image