ASAM/CLMP Protein, Mouse (HEK293, His)

ASAM/CLMP protein potentially participates in cell-cell adhesion, suggesting a role in adipocyte differentiation and obesity development. It is crucial for normal small intestine development, paralleling functions of related proteins. ASAM/CLMP Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag. The total length of ASAM/CLMP Protein, Mouse (HEK293, His) is 215 a.a., with molecular weight of ~30-35 kDa.

The ASAM/CLMP protein is potentially involved in cell-cell adhesion and may have a role in adipocyte differentiation and the development of obesity. It is also necessary for normal small intestine development, based on similarities with other proteins.

Measured by the ability of the immobilized protein to support the adhesion of the HUVEC human umbilical vein endothelial cell line. When 4x10⁴ cells/well are added to mouse ASAM coated plates (30 μg/mL, 100 μL/well), approximately 78.49% will adhere after 30 min at 37°C.

Mouse

HEK293

C-His

Q8R373 (T18-M232)

71566  [NCBI]

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

The protein migrates as approximately 30-35 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.