ASAM/CLMP Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
ASAM/CLMP protein potentially participates in cell-cell adhesion, suggesting a role in adipocyte differentiation and obesity development. It is crucial for normal small intestine development, paralleling functions of related proteins. ASAM/CLMP Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ASAM/CLMP protein potentially participates in cell-cell adhesion, suggesting a role in adipocyte differentiation and obesity development. It is crucial for normal small intestine development, paralleling functions of related proteins. ASAM/CLMP Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASAM/CLMP protein, expressed by HEK293 , with C-His labeled tag.
Background
The ASAM/CLMP protein is potentially involved in cell-cell adhesion and may have a role in adipocyte differentiation and the development of obesity. It is also necessary for normal small intestine development, based on similarities with other proteins.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of the HUVEC human umbilical vein endothelial cell line. When 4x104 cells/well are added to mouse ASAM coated plates (30 μg/mL, 100 μL/well), approximately 78.49% will adhere after 30 min at 37°C.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8R373 (T18-M232)
-
Molecular Construction
-
N-term
-
ASAM (T18-M232)
Accession # Q8R373 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLMP; Adipocyte-Specific Adhesion Molecule; CXADR Like Cell Adhesion Molecule; Adipocyte Adhesion Molecule; ASAM; CXADR-Like Membrane Protein; ACAM; FLJ22415; Coxsackie- And Adenovirus Receptor-Like Membrane Protein; CSBM; CXADR Like Membrane Protein; CSB
-
AA Sequence
THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGEPTEGSDLTLQCESASGTKPIVYYWQRIREKEGEDEHLPPKSRIDYNNPGRVLLQNLTMASSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM
-
Molecular Weight
Approximately 33-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
