ASGR2 Protein, Rat (Cell-Free, His)

The ASGR2 protein plays a key role in cellular processes by mediating the endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived ASGR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ASGR2 Protein, Rat (Cell-Free, His) is 301 a.a., with molecular weight of 41.1 kDa.

ASGR2 Protein plays a pivotal role in cellular processes by mediating the endocytosis of plasma glycoproteins from which the terminal sialic acid residue on complex carbohydrate moieties has been removed. Recognizing terminal galactose and N-acetylgalactosamine units, the receptor facilitates the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR2 is recycled back to the cell membrane surface. The protein's engagement in these dynamic processes highlights its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR2 also interacts with LASS2, broadening its molecular associations and suggesting potential roles in cellular signaling or coordination.

Rat

E. coli Cell-free

N-10*His

P08290 (M1-Y301)

29403

MEKDFQDIQQLDSEENDHQLIGDEEQGSHVQNLRTENPRWGGQPPSRPFPQRLCSKFRLSLLALAFNILLLVVICVVSSQSMQLQKEFWTLKETLSNFSTTTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDKDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKRDITY

41.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.