ATP5J2 Protein, Human (Cell-Free, His)
ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F(0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F(0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
The ATP5J2 protein is a part of the mitochondrial membrane ATP synthase, also known as Complex V, which is responsible for the synthesis of ATP from ADP in the presence of a proton gradient generated by the electron transport complexes of the respiratory chain. F-type ATPases are structured into two domains: F(1), encompassing the extramembraneous catalytic core, and F(0), housing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coordinated with proton translocation through a rotary mechanism involving the central stalk subunits. ATP5J2 is specifically located within the F(0) domain, serving as a minor subunit alongside subunit a in the membrane. The overall F-type ATPase complex includes CF(1), the catalytic core, and CF(0), the membrane proton channel, with specific subunits contributing to their distinct functions. ATP5J2 is a component of the larger ATP synthase complex, collaborating with various other subunits to facilitate ATP synthesis.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P56134 (M1-H94)
-
Gene ID9551
-
Molecular Construction
-
N-term
-
10*His
-
ATP5J2 (M1-H94)
Accession # P56134 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ATP5MF; ATP Synthase F Chain, Mitochondrial; Prev. ATP5J2; ATP Synthase, H+ Transporting, Mitochondrial F0 Complex, Subunit F, Isoform 2; ATP5JL; ATP Synthase, H+ Transporting, Mitochondrial F0 Complex, Subunit F2; ATP Synthase F(0) Complex Subunit F, Mit
-
AA Sequence
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
-
Predicted Molecular Mass
12.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
