ATP5J2 Protein, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F(0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F(0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

The ATP5J2 protein is a part of the mitochondrial membrane ATP synthase, also known as Complex V, which is responsible for the synthesis of ATP from ADP in the presence of a proton gradient generated by the electron transport complexes of the respiratory chain. F-type ATPases are structured into two domains: F(1), encompassing the extramembraneous catalytic core, and F(0), housing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coordinated with proton translocation through a rotary mechanism involving the central stalk subunits. ATP5J2 is specifically located within the F(0) domain, serving as a minor subunit alongside subunit a in the membrane. The overall F-type ATPase complex includes CF(1), the catalytic core, and CF(0), the membrane proton channel, with specific subunits contributing to their distinct functions. ATP5J2 is a component of the larger ATP synthase complex, collaborating with various other subunits to facilitate ATP synthesis.

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • ATP5J2 (M1-H94)
      Accession # P56134
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ATP5MF; ATP Synthase F Chain, Mitochondrial; Prev. ATP5J2; ATP Synthase, H+ Transporting, Mitochondrial F0 Complex, Subunit F, Isoform 2; ATP5JL; ATP Synthase, H+ Transporting, Mitochondrial F0 Complex, Subunit F2; ATP Synthase F(0) Complex Subunit F, Mit

  • AA Sequence

    MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

  • Predicted Molecular Mass

    12.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00