ATP5J2 Protein, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F(0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ATP5J2 Protein, Human (Cell-Free, His) is 94 a.a., with molecular weight of 12.4 kDa.

The ATP5J2 protein is a part of the mitochondrial membrane ATP synthase, also known as Complex V, which is responsible for the synthesis of ATP from ADP in the presence of a proton gradient generated by the electron transport complexes of the respiratory chain. F-type ATPases are structured into two domains: F(1), encompassing the extramembraneous catalytic core, and F(0), housing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coordinated with proton translocation through a rotary mechanism involving the central stalk subunits. ATP5J2 is specifically located within the F(0) domain, serving as a minor subunit alongside subunit a in the membrane. The overall F-type ATPase complex includes CF(1), the catalytic core, and CF(0), the membrane proton channel, with specific subunits contributing to their distinct functions. ATP5J2 is a component of the larger ATP synthase complex, collaborating with various other subunits to facilitate ATP synthesis.

Human

E. coli Cell-free

N-10*His

P56134 (M1-H94)

9551

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

12.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.