ATP6V1F Protein, Human (GST)
ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human (GST) is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human (GST) is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with N-GST labeled tag.
Background
ATP6V1F, a vital subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), constitutes part of the multisubunit enzyme that plays a central role in cellular pH regulation. This enzyme is a heteromultimeric assembly comprising two essential complexes: the ATP-hydrolytic V1 complex and the proton translocation V0 complex. Within the V1 complex, ATP6V1F contributes to the formation of the catalytic AB heterodimers, constituting a heterohexamer, and the peripheral stalks comprised of EG heterodimers. Additionally, it is an integral part of the central rotor, working in concert with subunit D. The V1 complex is responsible for ATP hydrolysis, whereas the V0 complex, in which ATP6V1F is not directly mentioned but is implied, is crucial for proton translocation across membranes. This proton transport involves various subunits, including the proton transport subunit a, a ring of proteolipid subunits c9c'', rotary subunit d, subunits e and f, and accessory subunits ATP6AP1/Ac45 and ATP6AP2/PRR. The cooperative action of these subunits underscores the significance of ATP6V1F in the intricate machinery of V-ATPase, which acidifies and maintains pH in cellular compartments and, in certain cell types, at the plasma membrane, thereby influencing various physiological processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q16864 (M1-R119)
-
Molecular Construction
-
N-term
-
GST
-
ATP6V1F (M1-R119)
Accession # Q16864 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ATP6V1F; Vacuolar Proton Pump Subunit F; ATPase H+ Transporting V1 Subunit F; V-ATPase 14 KDa Subunit; ATP6S14; H(+)-Transporting Two-Sector ATPase, 14kD Subunit; VATF; Adenosinetriphosphatase 14k Chain; V-Type Proton ATPase Subunit F; Vacuolar ATP Syntha
-
AA Sequence
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
-
Predicted Molecular Mass
40.2 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)