ATP6V1F Protein, Human (GST)

ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human (GST) is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ATP6V1F is an important subunit of the vacuolar (H+)-ATPase (V-ATPase) V1 complex and is an important component of this enzyme's role in cellular pH regulation. It forms a catalytic AB heterodimer and peripheral stem that plays a role in ATP hydrolysis. ATP6V1F Protein, Human (GST) is the recombinant human-derived ATP6V1F protein, expressed by E. coli , with N-GST labeled tag.

Background

ATP6V1F, a vital subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), constitutes part of the multisubunit enzyme that plays a central role in cellular pH regulation. This enzyme is a heteromultimeric assembly comprising two essential complexes: the ATP-hydrolytic V1 complex and the proton translocation V0 complex. Within the V1 complex, ATP6V1F contributes to the formation of the catalytic AB heterodimers, constituting a heterohexamer, and the peripheral stalks comprised of EG heterodimers. Additionally, it is an integral part of the central rotor, working in concert with subunit D. The V1 complex is responsible for ATP hydrolysis, whereas the V0 complex, in which ATP6V1F is not directly mentioned but is implied, is crucial for proton translocation across membranes. This proton transport involves various subunits, including the proton transport subunit a, a ring of proteolipid subunits c9c'', rotary subunit d, subunits e and f, and accessory subunits ATP6AP1/Ac45 and ATP6AP2/PRR. The cooperative action of these subunits underscores the significance of ATP6V1F in the intricate machinery of V-ATPase, which acidifies and maintains pH in cellular compartments and, in certain cell types, at the plasma membrane, thereby influencing various physiological processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • ATP6V1F (M1-R119)
      Accession # Q16864
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ATP6V1F; Vacuolar Proton Pump Subunit F; ATPase H+ Transporting V1 Subunit F; V-ATPase 14 KDa Subunit; ATP6S14; H(+)-Transporting Two-Sector ATPase, 14kD Subunit; VATF; Adenosinetriphosphatase 14k Chain; V-Type Proton ATPase Subunit F; Vacuolar ATP Syntha

  • AA Sequence

    MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

  • Predicted Molecular Mass

    40.2 kDa

  • Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00