2. Recombinant Proteins
  3. Receptor Proteins
  4. AVPR1B Protein, Human (Cell-Free, His)

AVPR1B Protein, Human (Cell-Free, His)

Cat. No.: HY-P702221
Handling Instructions

AVPR1B Protein, a receptor for arginine vasopressin, activates a phosphatidyl-inositol-calcium second messenger system through G proteins. In SARS-CoV-2 infection, AVPR1B may recognize and internalize a complex involving AVP/Arg-vasopressin, the SARS-CoV-2 spike protein, and secreted ACE2 via dynamin 2-dependent endocytosis. This suggests a potential role for AVPR1B in the cellular response to SARS-CoV-2 infection. AVPR1B Protein, Human (Cell-Free, His) is the recombinant human-derived AVPR1B protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of AVPR1B Protein, Human (Cell-Free, His) is 424 a.a., with molecular weight of 53.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AVPR1B Protein, a receptor for arginine vasopressin, activates a phosphatidyl-inositol-calcium second messenger system through G proteins. In SARS-CoV-2 infection, AVPR1B may recognize and internalize a complex involving AVP/Arg-vasopressin, the SARS-CoV-2 spike protein, and secreted ACE2 via dynamin 2-dependent endocytosis. This suggests a potential role for AVPR1B in the cellular response to SARS-CoV-2 infection. AVPR1B Protein, Human (Cell-Free, His) is the recombinant human-derived AVPR1B protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of AVPR1B Protein, Human (Cell-Free, His) is 424 a.a., with molecular weight of 53.0 kDa.
Background

The AVPR1B Protein acts as a receptor for arginine vasopressin, and its activity is mediated by G proteins, leading to the activation of a phosphatidyl-inositol-calcium second messenger system. Additionally, during SARS coronavirus-2 (SARS-CoV-2) infection, AVPR1B may recognize and internalize a complex formed by AVP/Arg-vasopressin, the SARS-CoV-2 spike protein, and secreted ACE2 through a dynamin 2-dependent endocytosis mechanism. This interaction highlights a potential role for AVPR1B in the cellular response to SARS-CoV-2 infection.
Species

Human
Source

E. coli Cell-free
Tag

N-10*His
Accession

P47901 (M1-F424)
Gene ID

553
Molecular Construction
N-term
10*His
AVPR1B (M1-F424)
Accession # P47901
C-term
Synonyms
Vasopressin V1b receptor; AVPR V1b; AVPR V3; Antidiuretic hormone receptor 1b; Vasopressin V3 receptor
AA Sequence

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF

Molecular Weight

53.0 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

AVPR1B Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AVPR1B Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702221
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.