B2M/Beta-2 microglobulin Protein, Rat (119a.a, HEK293, C-His)

Beta-2 microglobulin protein (B2M) is crucial in presenting antigens, aiding immune surveillance. B2M forms a complex with an alpha chain, creating MHC class I molecules for antigen recognition. It also participates in a heterotrimer with MR1, expanding its role in antigen presentation and immune signaling pathways. B2M's intricate interactions underscore its significance in orchestrating immune responses. B2M/Beta-2 microglobulin Protein, Rat (119a.a, HEK293, C-His) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Rat (119a.a, HEK293, C-His) is 119 a.a., with molecular weight of ~15 kDa.

As a crucial component of the class I major histocompatibility complex (MHC), Beta-2 microglobulin (B2M) plays a pivotal role in presenting peptide antigens to the immune system, contributing to immune surveillance and response. Operating within a heterodimeric structure, B2M forms a complex with an alpha chain to create major histocompatibility complex class I molecules, facilitating the recognition of antigens by immune cells. Notably, B2M functions as the beta-chain in this molecular arrangement. Furthermore, it engages in the formation of a heterotrimer with MR1 and a metabolite antigen, expanding its involvement in antigen presentation and immune signaling pathways. The intricate interactions and molecular partnerships underscore the significance of B2M in the orchestration of immune responses through the recognition and presentation of antigens.

Data is not available

Rat

HEK293

C-6*His

P07151 (M1-M119)

24223  [NCBI]

MARSVTVIFLVLVSLAVVLAIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.