B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His)

B2M or Beta-2 microglobulin binds to MHC class II protein complexes and forms homodimers. It responds to cadmium ions and exogenous stimuli and is present in the extracellular space. B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Rat (99a.a, HEK293, His) is 99 a.a., with molecular weight of approximately 13 kDa.

B2M, or Beta-2 microglobulin, is predicted to possess MHC class II protein complex binding activity and protein homodimerization activity. It plays a role in the response to cadmium ion and xenobiotic stimulus, and it is located in the extracellular space. B2M serves as a biomarker for conditions such as acute kidney failure, pyelonephritis, and ureteral obstruction. The human ortholog(s) of this gene have been implicated in various health conditions, including arthritis, familial visceral amyloidosis, immunodeficiency 43, and inflammatory bowel disease. B2M exhibits biased expression in tissues such as the spleen, lung, and nine other tissues, suggesting its involvement in diverse physiological processes.

Measured in a cell proliferation assay using U251 cells. ED₅₀ this effect is 26.10 ng/ml, corresponding to a specific activity is 38314.1762 units/mg.

• 
  Measured in a cell proliferation assay using U251 cells. The ED₅₀ for this effect is 26.10 ng/mL, corresponding to a specific activity is 38314.1762 units/mg.

Rat

HEK293

C-His

NP_036644 (I21-M119)

24223  [NCBI]

IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

approximately 13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.