B3GNT2 Protein, Human (HEK293, Fc)

B3GNT2 Protein, a member of the zinc-containing alcohol dehydrogenase family, is instrumental in oxidizing alcohols to their corresponding carbonyl compounds. Widely distributed across organisms, this enzyme, with a zinc ion in its active site, catalyzes substrate conversion through dehydrogenation. Beyond alcohol metabolism, B3GNT2 is crucial in diverse physiological processes, aiding alcohol detoxification and maintaining cellular redox balance. The family's presence underscores its evolutionary significance and physiological importance across different biological systems. B3GNT2 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GNT2 protein, expressed by HEK293, with N-hFc labeled tag. The total length of B3GNT2 Protein, Human (HEK293, Fc) is 369 a.a., with molecular weight of ~95-130 kDa.

Alcohol dehydrogenase, a member of the zinc-containing alcohol dehydrogenase family, plays a crucial role in the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme, widely distributed across various organisms, facilitates the metabolism of ethanol and other aliphatic alcohols. The zinc ion, a structural component of the active site, is instrumental in catalyzing the conversion of substrates through the dehydrogenation reaction. Beyond its pivotal role in alcohol metabolism, alcohol dehydrogenase is implicated in diverse physiological processes, contributing to the detoxification of alcohols and maintaining cellular redox balance. The presence of this enzyme family underscores its evolutionary significance and physiological importance across different biological systems.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

N-hFc

Q9NY97 (K29-C397)

10678  [NCBI]

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Approximately 95-130 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.