B3GNT2 Protein, Human (HEK293, Fc)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-hFc labeled tag.

Alcohol dehydrogenase, a member of the zinc-containing alcohol dehydrogenase family, plays a crucial role in the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme, widely distributed across various organisms, facilitates the metabolism of ethanol and other aliphatic alcohols. The zinc ion, a structural component of the active site, is instrumental in catalyzing the conversion of substrates through the dehydrogenation reaction. Beyond its pivotal role in alcohol metabolism, alcohol dehydrogenase is implicated in diverse physiological processes, contributing to the detoxification of alcohols and maintaining cellular redox balance. The presence of this enzyme family underscores its evolutionary significance and physiological importance across different biological systems.

No Enzyme Activity.

Human

HEK293

N-hFc

Q9NY97-1 (K29-C397)

10678  [NCBI]

Lumenal Domain

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Approximately 80-160 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.