BCAP31 Protein, Human (GST)

The BCAP31 protein acts as a chaperone and is one of the most abundant endoplasmic reticulum (ER) proteins. The BCAP31 protein also serves as a cargo receptor for transmembrane protein export. BCAP31 stimulates the translocation of NDUFS4 and NDUFB11 to mitochondria, interacts with BCL2, and may be involved in caspase-8-mediated apoptosis. BCAP31 Protein, Human (GST) is the recombinant human-derived BCAP31 protein, expressed by E. coli , with N-GST labeled tag. The total length of BCAP31 Protein, Human (GST) is 242 a.a., with molecular weight of ~54.5 kDa.

BCAP31 functions as a chaperone protein, recognized as one of the most abundant endoplasmic reticulum (ER) proteins. Its roles span various aspects of cellular processes, including serving as a chaperone for the export of secreted proteins in the ER, aiding in the identification of abnormally folded proteins and directing them to ER-associated degradation (ERAD). Additionally, BCAP31 acts as a cargo receptor for the export of transmembrane proteins. Notably, it contributes to the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by facilitating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria through interaction with TOMM40. Under ER stress conditions, BCAP31 undergoes delocalization from ER-mitochondria contact sites and engages in binding with BCL2. It is implicated in CASP8-mediated apoptosis and forms homodimers or heterodimers with BCAP29. BCAP31 is part of a complex involving BCAP29, BCL2, and/or BCL2L1, and it interacts with various proteins such as TOMM40, VDAC1, VAMP3, VAMP1, membrane IgD immunoglobulins, and HACD2, showcasing its multifaceted roles in cellular processes and protein-protein interactions.

Human

E. coli

N-GST

P51572 (2S-243K)

10134  [NCBI]

SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK

Approximately 54.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.