Bcl-2-like protein 11 Protein, Human (180a.a, N-His)

Bcl-2-like protein 11 (BCL2L11), despite its classification, does not interact with humanin. This unique feature distinguishes BCL2L11 from expected protein-protein interactions typically associated with Bcl-2 family members. Bcl-2-like protein 11 Protein, Human (180a.a, N-His) is the recombinant human-derived Bcl-2-like protein 11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Bcl-2-like protein 11 Protein, Human (180a.a, N-His) is 180 a.a., with molecular weight of approximately 25 kDa.

Bcl-2-like protein 11 (BCL2L11), also known as BIM, engages in critical protein interactions that modulate its cellular functions. Phosphorylated BCL2L11 interacts with USP27X, leading to BCL2L11 deubiquitination and subsequent stabilization. This interaction suggests a regulatory mechanism for BCL2L11 levels, influencing its role in apoptotic pathways. Additionally, BCL2L11 interacts with humanin, and this interaction serves a protective function by preventing BIM-induced apoptosis. The intricate interplay between BCL2L11, USP27X, and humanin highlights the complexity of apoptotic regulation and underscores the importance of post-translational modifications in modulating the stability and activity of BCL2L11. Further research is necessary to fully elucidate the molecular mechanisms and physiological implications of these interactions in cellular processes and potential implications for therapeutic interventions.

Human

E. coli

N-6*His

O43521-1 (M1-R180)

10018

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR

approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCL, pH 8.0, 10% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.