Blot21 Protein, Blomia tropicalis (His)
Based on 1 Customer Validation
Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Blot21, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 consists of three anti-parallel α-helices assembled in a helical bundle resembling that of Blot5 and Derp5[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
AAX34047.1 (L17-E129)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
Blot21 (L17-E129)
Accession # AAX34047.1 -
C-term
-
-
Protein Length
Full Length of Mite allergen Blo t 21 Chain
-
Synonyms
Mite allergen Blo t 21; Mite group 21 allergen Blo t 21; Blo t 21
-
AA Sequence
LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
