Blot21 Protein, Blomia tropicalis (His)

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.

Blot21, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 consists of three anti-parallel α-helices assembled in a helical bundle resembling that of Blot5 and Derp5^[1][2].

Others

E. coli

N-6*His

AAX34047.1 (L17-E129)

/

Partial

LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE

Approximately 13.5 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.