BMI1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

BMI1 protein functions as a key component of a Polycomb group (PcG) multiprotein PRC1-like complex, crucial for maintaining the transcriptionally repressive state of various genes, including Hox genes, throughout development. This PcG PRC1 complex operates through chromatin remodeling and histone modification, specifically mediating monoubiquitination of histone H2A at 'Lys-119' to impart heritable changes in chromatin expressibility. Within the PRC1-like complex, BMI1 regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacting with various partners such as RING1, CBX7, CBX8, and PHC2, BMI1 is a critical player in nucleosomal binding and modification of histone H2A. Additionally, BMI1 forms part of a larger complex containing CUL3 and SPOP and interacts with E4F1 and zinc finger protein ZNF277, suggesting its involvement in intricate protein networks that contribute to chromatin dynamics and gene regulation during development.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • BMI1 (M1-G326)
      Accession # P35226
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    BMI1; BMI1 Polycomb Ring Finger Proto-Oncogene; Prev. PCGF4; Polycomb Group Ring Finger 4; RNF51; Polycomb Group Protein Bmi1; Polycomb Group RING Finger Protein 4; Ring Finger Protein 51; Polycomb Complex Protein BMI-1; RING Finger Protein 51; B Lymphoma

  • AA Sequence

    MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

  • Predicted Molecular Mass

    36.9 kDa

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00