BMI1 Protein, Human (His)

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of BMI1 Protein, Human (E.coli,N-His) is 326 a.a., with molecular weight of ~43 kDa.

BMI1 protein functions as a key component of a Polycomb group (PcG) multiprotein PRC1-like complex, crucial for maintaining the transcriptionally repressive state of various genes, including Hox genes, throughout development. This PcG PRC1 complex operates through chromatin remodeling and histone modification, specifically mediating monoubiquitination of histone H2A at 'Lys-119' to impart heritable changes in chromatin expressibility. Within the PRC1-like complex, BMI1 regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacting with various partners such as RING1, CBX7, CBX8, and PHC2, BMI1 is a critical player in nucleosomal binding and modification of histone H2A. Additionally, BMI1 forms part of a larger complex containing CUL3 and SPOP and interacts with E4F1 and zinc finger protein ZNF277, suggesting its involvement in intricate protein networks that contribute to chromatin dynamics and gene regulation during development.

Human

E. coli

N-6*His

P35226 (M1-G326)

648

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Approximately 43 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.