BMI1 Protein, Human (His)
Based on 1 Customer Validation
BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
BMI1 protein functions as a key component of a Polycomb group (PcG) multiprotein PRC1-like complex, crucial for maintaining the transcriptionally repressive state of various genes, including Hox genes, throughout development. This PcG PRC1 complex operates through chromatin remodeling and histone modification, specifically mediating monoubiquitination of histone H2A at 'Lys-119' to impart heritable changes in chromatin expressibility. Within the PRC1-like complex, BMI1 regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacting with various partners such as RING1, CBX7, CBX8, and PHC2, BMI1 is a critical player in nucleosomal binding and modification of histone H2A. Additionally, BMI1 forms part of a larger complex containing CUL3 and SPOP and interacts with E4F1 and zinc finger protein ZNF277, suggesting its involvement in intricate protein networks that contribute to chromatin dynamics and gene regulation during development.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P35226 (M1-G326)
-
Gene ID648
-
Molecular Construction
-
N-term
-
6*His
-
BMI1 (M1-G326)
Accession # P35226 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BMI1; BMI1 Polycomb Ring Finger Proto-Oncogene; Prev. PCGF4; Polycomb Group Ring Finger 4; RNF51; Polycomb Group Protein Bmi1; Polycomb Group RING Finger Protein 4; Ring Finger Protein 51; Polycomb Complex Protein BMI-1; RING Finger Protein 51; B Lymphoma
-
AA Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
-
Predicted Molecular Mass
36.9 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)