BTNL2 Protein, Human (Cell-Free, His)

BTNL2 protein acts as a negative regulator of T-cell proliferation, crucially modulating the immune response. Its regulatory activity helps control T-cell division, contributing to immune reaction fine-tuning. This negative regulatory function underscores BTNL2's importance in maintaining immune homeostasis, preventing excessive T-cell proliferation, and highlighting its potential significance in immune-related disorders. BTNL2 Protein, Human (Cell-Free, His) is the recombinant human-derived BTNL2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of BTNL2 Protein, Human (Cell-Free, His) is 455 a.a., with molecular weight of 53.3 kDa.

BTNL2 protein functions as a negative regulator of T-cell proliferation, playing a crucial role in modulating the immune response. Through its regulatory activity, BTNL2 helps control the rate of T-cell division, contributing to the fine-tuning of immune reactions. This negative regulatory function underscores the importance of BTNL2 in maintaining immune homeostasis and preventing excessive T-cell proliferation, which could lead to uncontrolled immune responses. The precise mechanisms through which BTNL2 exerts its inhibitory effects on T-cell proliferation make it a key player in immune system modulation and highlight its potential significance in immune-related disorders.

Human

E. coli Cell-free

N-10*His

Q9UIR0 (M1-W455)

56244

MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

53.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.