BTNL4 Protein, Mouse (HEK293, His)
BTNL4 Protein, within the immunoglobulin superfamily, belongs to the BTN/MOG family. BTNL4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTNL4 Protein, within the immunoglobulin superfamily, belongs to the BTN/MOG family. BTNL4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
BTNL4 protein is a member of the immunoglobulin superfamily, falling within the BTN/MOG family.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
A2CG29 (Q29-W250)
-
Molecular Construction
-
N-term
-
BTNL4 (Q29-W250)
Accession # A2CG29 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Butyrophilin-like 4; Btnl4; Btn3a3
-
AA Sequence
QEFRVFGPSDPIVAAPGGEAILPCSVFPAMNVENMEELRWFRSRFSEAVLFYRDQEEQKEGQMPGYSQRTLLVKDQFHQGTAAVRILNVQASDSGIYICHFQQGVFYDEAILELKVAAMGSVPEVHIKGPEDGGVCVVCMTSGWYPEPQVHWKDSRGENLTAFSSETHTKDAEGLFSTETLLVVRDSSVRNVTCSIFNPILGQEKATAMFIPEPFFPQASPW
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
