1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. BTNL4
  5. BTNL4 Protein, Mouse (HEK293, His)

BTNL4 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7809
Handling Instructions

BTNL4 Protein, within the immunoglobulin superfamily, belongs to the BTN/MOG family. BTNL4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BTNL4 Protein, Mouse (HEK293, His) is 222 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTNL4 Protein, within the immunoglobulin superfamily, belongs to the BTN/MOG family. BTNL4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BTNL4 Protein, Mouse (HEK293, His) is 222 a.a., with molecular weight of 30-40 kDa.

Background

BTNL4 protein is a member of the immunoglobulin superfamily, falling within the BTN/MOG family.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

A2CG29 (Q29-W250)

Gene ID

632126  [NCBI]

Molecular Construction
N-term
BTNL4 (Q29-W250)
Accession # A2CG29
6*His
C-term
Synonyms
rMuButyrophilin, subfamily 3, member A3/BTNL4, His; BTN3A3; BTNL4; EG632126; NG11
AA Sequence

QEFRVFGPSDPIVAAPGGEAILPCSVFPAMNVENMEELRWFRSRFSEAVLFYRDQEEQKEGQMPGYSQRTLLVKDQFHQGTAAVRILNVQASDSGIYICHFQQGVFYDEAILELKVAAMGSVPEVHIKGPEDGGVCVVCMTSGWYPEPQVHWKDSRGENLTAFSSETHTKDAEGLFSTETLLVVRDSSVRNVTCSIFNPILGQEKATAMFIPEPFFPQASPW

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTNL4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTNL4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7809
Quantity:
MCE Japan Authorized Agent: