BTNL6 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
BTNL6 Protein, part of the immunoglobulin superfamily in the BTN/MOG family, is associated with immune responses and cellular recognition. Its membership suggests involvement in diverse immunological processes, potentially contributing to intricate immune regulation. Further exploration is needed to understand BTNL6's specific functions within the broader immunoglobulin superfamily context and its role in modulating immune responses. BTNL6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL6 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTNL6 Protein, part of the immunoglobulin superfamily in the BTN/MOG family, is associated with immune responses and cellular recognition. Its membership suggests involvement in diverse immunological processes, potentially contributing to intricate immune regulation. Further exploration is needed to understand BTNL6's specific functions within the broader immunoglobulin superfamily context and its role in modulating immune responses. BTNL6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL6 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
BTNL6 protein is a member of the immunoglobulin superfamily and is classified within the BTN/MOG family. This affiliation indicates its association with molecules involved in immune responses and cellular recognition. As a member of the immunoglobulin superfamily, BTNL6 likely participates in diverse immunological processes, potentially engaging in intricate interactions that contribute to immune regulation. Further exploration is warranted to elucidate the specific functions and implications of BTNL6 within the broader context of the immunoglobulin superfamily and its role in modulating immune responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
A2CG22 (K29-W249)
-
Gene ID624681 [NCBI]
-
Molecular Construction
-
N-term
-
BTNL6 (K29-W249)
Accession # A2CG22 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Butyrophilin-like 6; Btnl6
-
AA Sequence
KEFQVFGPSDPIVAAPGGEAILPCSVIPAMNVENMEELRWFRSRFSAAVLVYRDQEEQKREQLPEYSQRTSLVKEQFHQGTAAVRILNVQAPDSGIYICHFKQGVFYEEAILELKVAAMGSVPEVYIKGPEDGGVCVVCITSGWYPEPQVHWKDSRGEKLTASLEIHSEDAQGLFRTETSLVVRDSSVRNVTCSTFNPILGQEKAMAMFLPEPFFPKVSPW
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Histidine, 6% trehalose, 4% mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
