BZW2 Protein, Human (GST)

BZW2 is a translation initiation regulator that inhibits non-AUG and RAN-initiated translation. As a competitive inhibitor of EIF5, it improves initiation accuracy by preventing EIF5-dependent translation of non-AUG codons. BZW2 Protein, Human (GST) is the recombinant human-derived BZW2 protein, expressed by E. coli , with N-GST labeled tag. The total length of BZW2 Protein, Human (GST) is 419 a.a., with molecular weight of 75.2 kDa.

BZW2, a translation initiation regulator, functions as a suppressor of non-AUG initiated translation and repeat-associated non-AUG (RAN) initiated translation. It acts as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5), enhancing the accuracy of translation initiation. BZW2 achieves this by impeding EIF5-dependent translation from non-AUG codons, engaging in competition with EIF2S2 within the 43S pre-initiation complex (PIC). Notably, its interaction with EIF3C is essential for this competitive inhibition, and BZW2 also forms complexes with EIF3E and EIF2S2. This regulatory role underscores BZW2's significance in modulating translation initiation fidelity.

Human

E. coli

N-GST

Q9Y6E2 (M1-N419)

28969  [NCBI]

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

75.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.