BZW2 Protein, Human (GST)
BZW2 is a translation initiation regulator that inhibits non-AUG and RAN-initiated translation. As a competitive inhibitor of EIF5, it improves initiation accuracy by preventing EIF5-dependent translation of non-AUG codons. BZW2 Protein, Human (GST) is the recombinant human-derived BZW2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BZW2 is a translation initiation regulator that inhibits non-AUG and RAN-initiated translation. As a competitive inhibitor of EIF5, it improves initiation accuracy by preventing EIF5-dependent translation of non-AUG codons. BZW2 Protein, Human (GST) is the recombinant human-derived BZW2 protein, expressed by E. coli , with N-GST labeled tag.
Background
BZW2, a translation initiation regulator, functions as a suppressor of non-AUG initiated translation and repeat-associated non-AUG (RAN) initiated translation. It acts as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5), enhancing the accuracy of translation initiation. BZW2 achieves this by impeding EIF5-dependent translation from non-AUG codons, engaging in competition with EIF2S2 within the 43S pre-initiation complex (PIC). Notably, its interaction with EIF3C is essential for this competitive inhibition, and BZW2 also forms complexes with EIF3E and EIF2S2. This regulatory role underscores BZW2's significance in modulating translation initiation fidelity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9Y6E2-1 (M1-N419)
-
Molecular Construction
-
N-term
-
GST
-
BZW2 (M1-N419)
Accession # Q9Y6E2-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
BZW2; HSPC028; Basic Leucine Zipper And W2 Domains 2; MSTP017; EIF5-Mimic Protein 1; MST017; 5MP1; Uncharacterized Protein BZW2; Basic Leucine Zipper And W2 Domain-Containing Protein 2
-
AA Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
-
Predicted Molecular Mass
75.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
