CA125 Protein, Human (HEK293, His)

CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) produced in HEK293 cells, with His tag. CA125 is a giant mucin-like glycoprotein present on the cell surface of tumor cells^[1].

CA125 is a tumor antigen that has been defined as a marker primarily for ovarian carcinoma^[1].

1. Immobilized Human Mesothelin at 10 μg/mL (100 μl/well) can bind recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His).The ED₅₀ of recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His) is ≤2 μg/mL.
2. Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED₅₀ for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×10⁵ Unit/mg.

• 
  Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED₅₀ for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×10⁵ Unit/mg.

Human

HEK293

C-6*His

Q8WXI7 (G12660-M12923)

94025  [NCBI]

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMHHHHHH

40-80 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 50 mM Tris, 100 mM Glycine, pH 7.5 or 50 mM Tris-HCL, 300 mM NaCl, 100 mM Glycine, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Claudia Seelenmeyer, et al. The cancer antigen CA125 represents a novel counter receptor for galectin-1. J Cell Sci. 2003 Apr 1;116(Pt 7):1305-18.  [Content Brief]