Copy Link Print Information

CA125 Protein, Human (HEK293, His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CA125 Protein, Human (HEK293, His)
  • Experimental Validation Results for CA125 Protein, Human (HEK293, His)
  • CA125 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells[1][2][3][4][5][6][7].

Background

CA125 Protein (Human) is a counter receptor for galectin-1, as both soluble and membrane-associated fragments of CA125 derived from HeLa cell lysates are shown to bind specifically to human galectin-1 with high efficiency[1].
CA125 Protein (Human) is one of the mucin family proteins and is a serum tumor marker for various tumors, such as ovarian cancer, endometrial cancer, pancreatic cancer and bladder cancer[2].
CA-125 Protein (Human) is correlated with both peritoneal carcinomatosis on the diaphragm and residual disease (RD): A CA-125 (Human) value above 500 U/ml induction on the risk of diaphragmatic carcinomatosis is 3.5 times higher and the risk for residual disease of any size is increased by 2.4 times[3].
CA125 Protein (Human) is an antigen epitope found on mucin 16 (MUC16), a glycoprotein antigen present on the cell surface. Currently, 3 antibodies can help identify the CA125 antigen: OC125-like antibodies, M11-like antibodies and OV197-like antibodies. Postmenopausal women with a CA125 Protein (Human) level higher than 35 U/mL are considered to have a high risk of a malignancy[4].
CA125 Protein (Human) affects the cellular function of cancer cells, including fending off cytotoxic natural killer cell attacks and modulating intracellular signaling pathways in cancer cells or noncancer cells in the tumor-microenvironment (TM)[5].

In Vitro

The N-, O-linked sugar moieties and and the proteinaceous core structure of CA125 Protein (Human) contribute to the specificity of galectin recruitment. Additionally, CA125-C-TERM binding to galectin-1 largely depends on O-linked β-galactose-terminated oligosaccharide chains[1].
The expression levels of M2 macrophage marker, CD163 and regulatory T-cell (Treg) marker, FOXP3 are higher in CD125 Protein (Human)-high group than in CD125 Protein (Human)-low group, suggesting CD125 Protein (Human)-high bladder cancers have the immunosuppressive tumor-microenvironment (iTM)[5].

In Vivo

The affinity of CA125 protein (Human) for monoclonal antibody 196-14 is higher than that for monoclonal antibody 196-28 in nude mice bearing OVA-5 xenografts[7].

Verified Bioactivity

1. Immobilized Human Mesothelin (HY-P700426) at 10 μg/mL (100 μl/well) can bind recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His).The ED50 of recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His) is ≤2 μg/mL.
2. Immobilized Recombinant Human MPF (HY-P70413) Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8WXI7 (G12660-M12923)

  • Gene ID
    94025  [NCBI]
  • Molecular Construction
    • N-term
    • CA125 (G12660-M12923)
      Accession # Q8WXI7
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MUC16; FLJ14303; Mucin 16, Cell Surface Associated; Mucin-16; CA125; CA125 Ovarian Cancer Antigen; CA-125; Mucin-16 Short Isoform; Ovarian Cancer-Related Tumor Marker CA125; Mucin-16 Long Isoform; Ovarian Carcinoma Antigen CA125; MUC-16; Cancer Antigen 12

  • AA Sequence

    GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

  • Molecular Weight

    Approximately 40-70 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 100 mM glycine, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 100 mM glycine, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Claudia Seelenmeyer, et al. The cancer antigen CA125 represents a novel counter receptor for galectin-1. J Cell Sci. 2003 Apr 1;116(Pt 7):1305-18. [Content Brief]

[2]. Jacobs I,et al. The CA 125 tumour-associated antigen: a review of the literature. Hum Reprod. 1989 Jan;4(1):1-12. [Content Brief]

[3]. Plana A, et al. Radiologically enlarged cardiophrenic lymph nodes and CA-125 in relation to diaphragmatic carcinomatosis, surgical outcome, and overall survival in advanced ovarian cancer. Acta Oncol. 2023 May;62(5):451-457. [Content Brief]

[4]. Zhang R, et al. Molecular Biomarkers for the Early Detection of Ovarian Cancer. Int J Mol Sci. 2022 Oct 10;23(19):12041. [Content Brief]

[5]. Yamashita T, et al. Cancer Antigen 125 Expression Enhances the Gemcitabine/Cisplatin-Resistant Tumor Microenvironment in Bladder Cancer. Am J Pathol. 2023 Mar;193(3):350-361. [Content Brief]

[6]. Kobayashi H, et al. A human/mouse chimeric monoclonal antibody against CA125 for radioimmunoimaging of ovarian cancer. Cancer Immunol Immunother. 1993 Aug;37(3):143-9. [Content Brief]

[7]. Saga T, et al. An antibody-tumor model for the targeting of CA125-producing gynecologic malignancies[J]. Japanese journal of cancer research, 1990, 81(11): 1141-1148. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.

  • CA125 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CA125 Protein, Human (HEK293, His)
  • Experimental Validation Results for CA125 Protein, Human (HEK293, His)
  • CA125 Protein, Human (HEK293, His) Product Image