1. Recombinant Proteins
  2. CAR-T related Proteins
  3. CA-125
  4. CA125 Protein, Human (HEK293, His)

CA125 Protein, Human (HEK293, His)

Cat. No.: HY-P7696
COA Handling Instructions

CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) produced in HEK293 cells, with His tag. CA125 is a giant mucin-like glycoprotein present on the cell surface of tumor cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $120 In-stock
50 μg $350 In-stock
100 μg $600 In-stock
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) produced in HEK293 cells, with His tag. CA125 is a giant mucin-like glycoprotein present on the cell surface of tumor cells[1].

Background

CA125 is a tumor antigen that has been defined as a marker primarily for ovarian carcinoma[1].

Biological Activity

1. Immobilized Human Mesothelin at 10 μg/mL (100 μl/well) can bind recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His).The ED50 of recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His) is 0.6 μg/mL.
2. Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.

  • Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8WXI7 (G12660-M12923)

Gene ID
Synonyms
rHuCA125, His; CA125 ovarian cancer antigen; CA125; CA125MUC-16;
AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMHHHHHH

Molecular Weight

40-80 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, 100 mM Glycine, pH 7.5 or 50 mM Tris-HCL, 300 mM NaCl, 100 mM Glycine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CA125 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CA125 Protein, Human (HEK293, His)
Cat. No.:
HY-P7696
Quantity:
MCE Japan Authorized Agent: