Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His)
Based on 1 Customer Validation
Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing Receptor/CaSR Protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing Receptor/CaSR Protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The Calcium-sensing Receptor/CaSR Protein, a G-protein-coupled receptor, plays a pivotal role in detecting changes in extracellular calcium concentration, crucial for maintaining calcium homeostasis. This receptor senses fluctuations in circulating calcium levels and modulates the production of parathyroid hormone (PTH) in parathyroid glands. Its activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. The receptor's activation involves a co-agonist mechanism, where aromatic amino acids such as Trp or Phe, in concert with divalent cations like calcium or magnesium, achieve full activation. In the resting state, the receptor adopts an open conformation, with anion binding promoting the inactive configuration. Upon aromatic amino acid binding, the extracellular venus flytrap module groove closes, inducing a novel homodimer interface between subunits. Calcium ions further stabilize the active state by enhancing homodimer interactions between membrane-proximal domains. Notably, the receptor can be activated by AMG 416, a D-amino acid-containing peptide agonist under evaluation for treating secondary hyperparathyroidism in chronic kidney disease patients receiving hemodialysis, with AMG 416 acting through the formation of a disulfide bond with Cys-482.
Verified Bioactivity
Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P41180-1 (Y20-K601)
-
Molecular Construction
-
N-term
-
CASR (Y20-K601)
Accession # P41180-1 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CASR; Parathyroid Ca(2+)-Sensing Receptor 1; Prev. HHC1; Hypocalciuric Hypercalcemia 1; Prev. HHC; Calcium-Sensing Receptor; GPRC2A; HYPOC1; Extracellular Calcium-Sensing Receptor; PCaR1; NSHPT; EIG8; FHH; CaSR; Parathyroid Cell Calcium-Sensing Receptor 1
-
AA Sequence
YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK
-
Molecular Weight
Approximately 90-110 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)