Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing Receptor/CaSR Protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing Receptor/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing Receptor/CaSR Protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Calcium-sensing Receptor/CaSR Protein, a G-protein-coupled receptor, plays a pivotal role in detecting changes in extracellular calcium concentration, crucial for maintaining calcium homeostasis. This receptor senses fluctuations in circulating calcium levels and modulates the production of parathyroid hormone (PTH) in parathyroid glands. Its activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. The receptor's activation involves a co-agonist mechanism, where aromatic amino acids such as Trp or Phe, in concert with divalent cations like calcium or magnesium, achieve full activation. In the resting state, the receptor adopts an open conformation, with anion binding promoting the inactive configuration. Upon aromatic amino acid binding, the extracellular venus flytrap module groove closes, inducing a novel homodimer interface between subunits. Calcium ions further stabilize the active state by enhancing homodimer interactions between membrane-proximal domains. Notably, the receptor can be activated by AMG 416, a D-amino acid-containing peptide agonist under evaluation for treating secondary hyperparathyroidism in chronic kidney disease patients receiving hemodialysis, with AMG 416 acting through the formation of a disulfide bond with Cys-482.

Verified Bioactivity

Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CASR (Y20-K601)
      Accession # P41180-1
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CASR; Parathyroid Ca(2+)-Sensing Receptor 1; Prev. HHC1; Hypocalciuric Hypercalcemia 1; Prev. HHC; Calcium-Sensing Receptor; GPRC2A; HYPOC1; Extracellular Calcium-Sensing Receptor; PCaR1; NSHPT; EIG8; FHH; CaSR; Parathyroid Cell Calcium-Sensing Receptor 1

  • AA Sequence

    YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK

  • Molecular Weight

    Approximately 90-110 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00