1. Recombinant Proteins
  2. Others
  3. Calreticulin/CALR Protein, Mouse (P.pastoris, His)

Calreticulin/CALR Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71721
COA Handling Instructions

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Calreticulin/CALR Protein, Mouse (P.pastoris, His) is 399 a.a., with molecular weight of ~48.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $164 In-stock
10 μg $278 In-stock
50 μg $700 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Calreticulin/CALR Protein, Mouse (P.pastoris, His) is 399 a.a., with molecular weight of ~48.3 kDa.

Background

Calreticulin/CALR protein, a calcium-binding chaperone, orchestrates crucial functions in the endoplasmic reticulum (ER) through the calreticulin/calnexin cycle, promoting the folding, oligomeric assembly, and quality control of glycoproteins. This lectin transiently interacts with nearly all monoglucosylated glycoproteins synthesized in the ER, contributing to their proper maturation and function. Beyond its role in glycoprotein processing, CALR is involved in diverse cellular processes. It interacts with the DNA-binding domain of NR3C1, mediating its nuclear export and influencing gene expression regulation. Furthermore, CALR may play a role in oocyte maturation by regulating calcium homeostasis and participating in the cortical reaction during oocyte activation, potentially contributing to the block against polyspermy. CALR forms complexes with various proteins, including GABARAP, PDIA3/ERp57, and TRIM21, highlighting its versatile interactions within cellular pathways. It also engages in intricate protein-protein interactions with PPIB, SPACA9, and CLCC1, underscoring its involvement in diverse cellular processes and protein complexes.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P14211 (D18-L416)

Gene ID

12317  [NCBI]

Molecular Construction
N-term
6*His
CALR (D18-L416)
Accession # P14211
C-term
Synonyms
Calr; Calreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
AA Sequence

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Weight

Approximately 48.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS,6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calreticulin/CALR Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calreticulin/CALR Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71721
Quantity:
MCE Japan Authorized Agent: